| Version: | 2.1.1 |
| Title: | Analyze Experimental High-Throughput (Omics) Data |
| Author: | Wolfgang Raffelsberger [aut, cre] |
| Maintainer: | Wolfgang Raffelsberger <w.raffelsberger@gmail.com> |
| Description: | The efficient treatment and convenient analysis of experimental high-throughput (omics) data gets facilitated through this collection of diverse functions. Several functions address advanced object-conversions, like manipulating lists of lists or lists of arrays, reorganizing lists to arrays or into separate vectors, merging of multiple entries, etc. Another set of functions provides speed-optimized calculation of standard deviation (sd), coefficient of variance (CV) or standard error of the mean (SEM) for data in matrixes or means per line with respect to additional grouping (eg n groups of replicates). A group of functions facilitate dealing with non-redundant information, by indexing unique, adding counters to redundant or eliminating lines with respect redundancy in a given reference-column, etc. Help is provided to identify very closely matching numeric values to generate (partial) distance matrixes for very big data in a memory efficient manner or to reduce the complexity of large data-sets by combining very close values. Other functions help aligning a matrix or data.frame to a reference using partial matching or to mine an experimental setup to extract patterns of replicate samples. Many times large experimental datasets need some additional filtering, adequate functions are provided. Convenient data normalization is supported in various different modes, parameter estimation via permutations or boot-strap as well as flexible testing of multiple pair-wise combinations using the framework of 'limma' is provided, too. Batch reading (or writing) of sets of files and combining data to arrays is supported, too. |
| VignetteBuilder: | knitr |
| Depends: | R (≥ 3.1.0) |
| Imports: | grDevices, graphics, MASS, stats, utils |
| Suggests: | BBmisc, boot, coin, data.table, data.tree, fdrtool, flexclust, knitr, limma, markdown, mixdist, NbClust, preprocessCore, qvalue, Rcpp, RColorBrewer, readxl, rmarkdown, som, stringi, VGAM, vsn, wrGraph |
| License: | GPL-3 |
| Encoding: | UTF-8 |
| Config/roxygen2/version: | 8.0.0 |
| NeedsCompilation: | no |
| Packaged: | 2026-07-20 12:52:35 UTC; wraff |
| Repository: | CRAN |
| Date/Publication: | 2026-07-20 14:20:02 UTC |
Add letter to all elements but not last
Description
This function allows to add 'addChr' to all entries, without the last entry
Usage
.addLetterWoLast(x, addChr)
Arguments
x |
(character) main input |
addChr |
(character) |
Value
This function returns a modified character vector
See Also
paste; used in cutAtMultSites
Examples
.addLetterWoLast(c("abc","efgh"),"Z")
Calculate ratios for each column to each column of reference-matrix
Description
This function calculates ratio(s) for each column of matrix 'x' versus all/each column(s) of matrix 'y' (reference)
Usage
.allRatioMatr1to2(x, y, asLog2 = TRUE, sumMeth = "mean", callFrom = NULL)
Arguments
x |
(matrix or data.frame) main input1 |
y |
(matrix or data.frame) main input2 |
asLog2 |
(logical) |
sumMeth |
(character) method |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a numeric vector or matrix in dimension of 'x' (so far summarize all ratios from mult division from mult ref cols as mean or median )
See Also
Examples
.allRatioMatr1to2(matrix(11:14, ncol=2), matrix(21:24, ncol=2))
Search character-string and cut either before or after
Description
This function extracts/cuts text-fragments out of txt following specific anchors defined by arguments cutFrom and cutTo.
Usage
.allRatios(dat, ty = "log2", colNaSep = "_")
Arguments
dat |
(matrix or data.frame) main input |
ty |
(character) type of ratio (eg 'log2') |
colNaSep |
(character) separator |
Value
This function returns a numeric vector
See Also
Examples
.allRatios(matrix(11:14, ncol=2))
Summarize along columns of multiple arrays in list
Description
This function allows summarizing along columns of multiple arrays in list
Usage
.arrLstMean(
arrLst,
sumType = "mean",
arrOutp = FALSE,
signifDig = 3,
formatCheck = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
arrLst |
(list) main input |
sumType |
(character) |
arrOutp |
(logical) |
signifDig |
(integer) |
formatCheck |
(logical) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
array (1st dim will be summary along cols, rows will be layers of 3rd array-dim
See Also
used in cutArrayInCluLike
Examples
.datSlope(c(3:6))
Summarize along columns of mult arrays in list
Description
This function allows summarizing along columns of mult arrays in list
Usage
.arrLstSEM(
arrLst,
arrOutp = FALSE,
signifDig = 3,
formatCheck = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
arrLst |
(list) main input |
arrOutp |
(logical) |
signifDig |
(integer) |
formatCheck |
(logical) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
array (1st dim will be summary along cols, rows will be layers of 3rd array-dim ie dim(arrLst[[1]])[3])
See Also
used in cutArrayInCluLike
Examples
.datSlope(c(3:6))
Convert anything to data.frame
Description
This function allows converting anything to data.frame
Usage
.asDF2(z)
Arguments
z |
(numeric vector, factor, matrix or list) main input |
Value
data.frame
See Also
Examples
.asDF2(c(3:6))
Get series of values after last discontinuity
Description
This function aims to get series of values after last discontinuity
Usage
.breakInSer(x, getFrom = "last")
Arguments
x |
(numeric) main input |
getFrom |
(character) |
Value
This function returns a numeric vector of reduced length
See Also
Examples
.breakInSer(c(11:14,16:18))
Bring most extreme to center
Description
This function aims to bring most extreme value to center
Usage
.bringToCtr(aa, ctr, ctrFa = 0.75)
Arguments
aa |
(numeric) main input |
ctr |
(numeric) 'control' |
ctrFa |
(numeric <1) modulate amplitude of effect |
Value
This function returns an adjusted numeric vector
See Also
Examples
.bringToCtr(11:14, 9)
Check argument names
Description
This function allows checking of argument names
Usage
.checkArgNa(x, argNa, lazyEval = TRUE)
Arguments
x |
(character) main input |
argNa |
(character) argument name |
lazyEval |
(logical) decide if argument should be avaluated with abbreviated names, too |
Value
This function returns a elongated character vector
See Also
Examples
.checkArgNa("Abc",c("ab","Ab","BCD"))
Check list of arrays for consistent dimensions of all arrays
Description
This function allows to check list of arrays for consistent dimensions of all arrays
Usage
.checkConsistentArrList(
arrLst,
arrNDim = 3,
fxName = NULL,
varName = NULL,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
arrLst |
(list) main input |
arrNDim |
(integer) number of dimensions for arrays |
fxName |
(character) this name will be given in message |
varName |
(character) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
list
See Also
used in cutArrayInCluLike
Examples
.datSlope(c(3:6))
Convert To Simple Vector (similar to unlist)
Description
This function allows converting 'dat' (may be list, data.frame etc) to simple vector, more elaborate than unlist()
Usage
.checkConvt2Vect(dat, toNumeric = TRUE)
Arguments
dat |
(list, data.frame) main input |
toNumeric |
(logical) |
Value
This function returns a character (or numeric) vector
See Also
unlist; used in equLenNumber
Examples
aa <- matrix(11:14, ncol=2)
.checkConvt2Vect(aa)
Check Factor
Description
This function was designed to check a factor object
Usage
.checkFactor(
fac,
facNa = NULL,
minLev = 2,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
fac |
(factor) main input |
facNa |
(character) level-names |
minLev |
(integer) minium number of levels |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a corrceted/adjusted factor
See Also
Examples
.checkFactor(gl(3,2))
Check File Name Extensions Function for checking file-names.
Description
Check File Name Extensions Function for checking file-names.
Usage
.checkFileNameExtensions(fileNa, ext)
Arguments
fileNa |
(character) file name to be checked |
ext |
(character) file extension |
Value
modified character vector
Examples
.checkFileNameExtensions("testFile.txt","txt")
Check argument for Location of legend
Description
This function allows checking an argument for Location of legend, if value provided not found as valid, it returns 'defLoc
Usage
.checkLegendLoc(
legLoc,
defLoc = "topright",
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
legLoc |
(character) main input |
defLoc |
(character) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a character vector designing the potential location of legend
See Also
Examples
.checkLegendLoc("abc")
Compare 'dat' to confindence interval of linare model 'lMod' (eg from lm())
Description
This function allows to compare 'dat' to confindence interval of linare model 'lMod' (eg from lm())
Usage
.checkLmConfInt(dat, lMod, level = 0.95)
Arguments
dat |
matrix or data.frame, main input |
lMod |
linear model, only used to extract coefficients offset & slope |
level |
(numeric) alpha threshold for linear model |
Value
This function returns a logical vector for each value in 2nd col of 'dat' if INSIDE confid interval
See Also
Examples
set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10)
Check regression arguments
Description
This function allows to check arguments for linear regression. Used as argument checking for regrBy1or2point and regrMultBy1or2point
Usage
.checkRegrArguments(inData, refList, regreTo, callFrom = NULL)
Arguments
inData |
(numeric vector) main input |
refList |
(list) |
regreTo |
(numeric vector) |
callFrom |
(character) allow easier tracking of messages produced |
Value
list
See Also
Examples
.datSlope(c(3:6))
Automatic choice of colors
Description
This function allows to do automatic choice of colors: if single-> grey, if few -> RColorBrewer, if many : gradient green -> grey/red
Usage
.chooseGrpCol(
nGrp,
paired = FALSE,
alph = 0.2,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
nGrp |
(numeric vector) main input |
paired |
(logical) |
alph |
(numeric vector) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced#' |
Value
This function returns a character vector with color codes
See Also
Examples
.chooseGrpCol(4)
Combine annotation information from list of matrixes
Description
This function allows to combine information (annotation) from list of matrixes (ie replace when NA), using always the columns specified in 'useCol' (numeric)
Usage
.combineListAnnot(
lst,
useCol = 1:2,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
lst |
(list) main input |
useCol |
(numeric vector) which columns should be used |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a single matrix of combined (non-redundant) info
See Also
used in cutArrayInCluLike
Examples
.datSlope(c(3:6))
Compare by distance/difference
Description
This function allows to compare by distance/difference
Usage
.compareByDiff(dat, limit, distVal = FALSE)
Arguments
dat |
list of 2 numerical vectors |
limit |
(numeric, length=1) threshold value for retaining values, used with distace-type specified in argument 'compTy' |
distVal |
(logical) to toggle outpout as matrix of numeric (distance values above 'limit', others NA) or matrix of logical |
Value
This function returns a list with close matches of 'x' to given 'y', the numeric value dependes on 'sortMatch' (if FASLE then always value of 'y' otherwise of longest of x&y)
See Also
findCloseMatch, checkSimValueInSer, and also .compareByLogRatio, for convient output countCloseToLimits
Examples
cc <- list(aa=11:14, bb=c(13.1,11.5,14.3,20:21))
Compare by log-ratio
Description
This function allows to compare by log-ratio
Usage
.compareByLogRatio(dat, limit, distVal = FALSE)
Arguments
dat |
list of 2 numerical vectors |
limit |
(numeric, length=1) threshold value for retaining values, used with distace-type specified in argument 'compTy' |
distVal |
(logical) to toggle outpout as matrix of numeric (distance values above 'limit', others NA) or matrix of logical |
Value
This function returns a list with close matches of 'x' to given 'y', the numeric value dependes on 'sortMatch' (if FASLE then always value of 'y' otherwise of longest of x&y)
See Also
findCloseMatch, checkSimValueInSer, and also .compareByDiff, for convient output countCloseToLimits
Examples
cc <- list(aa=11:14, bb=c(13.1,11.5,14.3,20:21))
.compareByLogRatio(cc, 1)
Compare by PPM
Description
This function allows to compare by ppm
Usage
.compareByPPM(dat, limit, distVal = FALSE)
Arguments
dat |
list of 2 numerical vectors |
limit |
(numeric, length=1) threshold value for retaining values, used with distace-type specified in argument 'compTy' |
distVal |
(logical) to toggle outpout as matrix of numeric (distance values above 'limit', others NA) or matrix of logical |
Value
This function returns a list with close matches of 'x' to given 'y', the numeric value dependes on 'sortMatch' (if FASLE then always value of 'y' otherwise of longest of x&y)
See Also
findCloseMatch, checkSimValueInSer, and also .compareByDiff, for convient output countCloseToLimits
Examples
cc <- list(aa=11:14, bb=c(13.1,11.5,14.3,20:21))
.compareByPPM(cc, 1)
Search (complementing) Columns For Best Coverage Of Non-NA Data For rowNormalization (main)
Description
This function was designed to complete the selection of columns of sparse matrix 'dat' with sets of 'nCombin' columns at complete 'coverage' Context : In sparse matrix 'dat' search subsets of columns with some rows as complete (no NA).
Usage
.complCols(x, dat, nCombin)
Arguments
x |
(integer, length=1) column number for with other columns to combine & give (some) complete non-NA lines are seeked |
dat |
(matrix) .. init data, smay be parse matrix with numerous NA |
nCombin |
(integer) .. number of columns used to make complete subset |
Value
This function returns a matrix of column-indexes complementing (nCombin rows)
See Also
Examples
.complCols(3, dat=matrix(c(NA,12:17,NA,19),ncol=3), nCombin=3)
Compose Sequence Of (Function-)Calls
Description
This function was designed for tracing the hierarchy of function-calls. It allows to remove any tailing space or ': ' from 'callFrom' (character vector) and return with added 'newNa' (+ 'add2Tail')
Usage
.composeCallName(newNa, add2Head = "", add2Tail = " : ", callFrom = NULL)
Arguments
newNa |
(character vector) main input |
add2Head |
(character) |
add2Tail |
(character) |
callFrom |
(character) may also contain multiple separate names (ie length >1), will be concatenated using ' -> ' |
Value
This function returns a character vector (history of who called whom)
See Also
Examples
.composeCallName("newFunction", callFrom="initFunction")
Convert numeric matrix to numeric
Description
Take matrix and return vector
Usage
.convertMatrToNum(matr, useCol = NULL)
Arguments
matr |
(matrix) main input |
useCol |
(integer) design the comumns to be used |
Value
numeric vector
See Also
Examples
.convertMatrToNum(matrix(1:6, ncol=2))
Convert/standardize names of 'query' to standard names from 'ref'
Description
This function converts/standardizes names of 'query' to standard names from 'ref' (list of possible names (char vect) where names define standardized name). It takes 'query' as character vector and return character vecor (same length as 'query') with 'converted/corrected' names
Usage
.convertNa(query, ref, partMatch = TRUE)
Arguments
query |
(matrix or data.frame, min 2 columns) main input |
ref |
(list) list of multiple possible names associated to given group, reference name for each group is name of list |
partMatch |
(logical) allows partial matching (ie name of 'ref' must be in head of 'query') |
Value
This function returns a character vector
Examples
daPa <- matrix(c(1:5,8,2:6,9), ncol=2)
Avoid duplicating items between 'curNa' and 'newNa' by incrementing digits after 'extPref' (in newNa)
Description
This function aims to avoid duplicating items between 'curNa' and 'newNa' by incrementing digits after 'extPref' (in newNa)
Usage
.corDuplItemsByIncrem(newNa, curNa, extPref = "_s")
Arguments
newNa |
(character) main input 1 |
curNa |
(character) main input 2 |
extPref |
(character) extension |
Value
This function returns the corrected input vector newNa
See Also
Examples
.corDuplItemsByIncrem(letters[1:6], letters[8:4])
Search character-string and cut either before or after
Description
This function extracts/cuts text-fragments out of txt following specific anchors defined by arguments cutFrom and cutTo.
Usage
.cutAtSearch(
x,
searchChar,
after = TRUE,
silent = TRUE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
character vector to be treated |
searchChar |
(character) text to look for |
after |
(logical) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a modified character vector
See Also
Examples
.cutAtSearch("abcdefg","de")
Cut string to get all variants from given start with min and max length
Description
This function allows truncating character vector to all variants from given start, with min and optonal max length Used to evaluate argument calls without giving full length of argument
Usage
.cutStr(txt, startFr = 1, minLe = 1, maxLe = NULL, reverse = TRUE)
Arguments
txt |
(character) main input, may be length >1 |
startFr |
(interger) where to start |
minLe |
(interger) minimum length of output |
maxLe |
(interger) maximum length of output |
reverse |
(logical) return longest text-fragments at beginning of vector |
Value
This function returns a character vector
See Also
Examples
.cutStr("abcdefg", minLe=2)
Model linear regression and optional plot
Description
This function allows to model a linear regression and optionally to plot the results
Usage
.datSlope(
dat,
typeOfPlot = "sort",
toNinX = FALSE,
plotData = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat |
(vector or matrix) main input |
typeOfPlot |
(character) |
toNinX |
(logical) |
plotData |
(logical) |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
numeric vector with intercept and slope, optional plot
See Also
Examples
.datSlope(c(3:6))
Return File-name Extensions Including Double Extensions (eg txt.gz)
Description
This function allows retreiving extensions to filenames similar to file_ext, but also alllows to retreive selected double-extensions (txt.gz).
The leading dor will ne excluded similar to file_ext
Usage
.doubleExt(fiNa, termExt = c("gz", "zip"))
Arguments
fiNa |
(character) name of file to be tested (may include path) |
termExt |
(character) additional terminal extensions |
Details
The argument termExt allows specifying additional (terminal) extensions to be recognized.
Value
This function returns a character vector with file-extensions (excluding the leading dot). (Only purely alphanumeric extensions are recognized.)
See Also
Examples
fi <- c("ab","ab.c","ab.c.gz","ab.d","ab.d.zip","ab.e")
.doubleExt(fi)
Extract NA-neighbour values
Description
This function allows extracting NA-neighbour value
Usage
.extrNAneighb(x, grp)
Arguments
x |
initial matrix to treat |
grp |
(factor) grouing of replicates |
Value
This function returns a numeric vector
See Also
unique, nonAmbiguousNum, faster than firstOfRepeated which gives more detail in output (lines/elements/indexes of omitted)
Examples
.extrNAneighb(c(11:14,NA), rep(1,5))
Extract number(s) before capital character
Description
This function aims to extract number(s) before capital character
Usage
.extrNumHeadingCap(x)
Arguments
x |
character vector to be treated |
Value
This function returns a numeric vector
See Also
Examples
.extrNumHeadingCap(" 1B ")
Extract numbers before separator followed by alphabetic character
Description
This function aims to extract number(s) before separator followed by alphabetic character (return named numeric vector, NAs when no numeric part found)
Usage
.extrNumHeadingSepChar(x, sep = "_")
Arguments
x |
character vector to be treated |
sep |
(character) separator |
Value
This function returns a numeric vector
See Also
Examples
.extrNumHeadingSepChar(" 1B ")
Filter for size
Description
This function aims to filter for size
Usage
.filtSize(x, minSize = 5, maxSize = 36)
Arguments
x |
main inpuy |
minSize |
(integer) minimum number of characters, if |
maxSize |
(integer) maximum number of characters |
Value
This function returns a list of filtered input
See Also
filtSizeUniq; correctToUnique, unique, duplicated
Examples
aa <- 1:10
Filter nodes & edges for extracting networks (main)
This function allows extracting and filtering network-data based on fixed threshold (limInt) and add sandwich-nodes (nodes inter-connecting initial nodes) out of node-based queries.
Description
Filter nodes & edges for extracting networks (main)
This function allows extracting and filtering network-data based on fixed threshold (limInt) and add sandwich-nodes (nodes inter-connecting initial nodes) out of node-based queries.
Usage
.filterNetw(
lst,
remOrphans = TRUE,
reverseCheck = TRUE,
filtCol = 2,
callFrom = NULL,
silent = FALSE,
debug = FALSE
)
Arguments
lst |
(list, composed of multiple matrix or data.frames ) main input (each list-element should have same number of columns) |
remOrphans |
(logical) remove networks consisting only of 2 connected edges |
reverseCheck |
(logical) |
filtCol |
(integer, length=1) which column of |
callFrom |
(character) allow easier tracking of message(s) produced |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
Value
This function returns a matrix or data.frame
See Also
filterNetw and other CRAN package dedeicated to networks
Examples
ab <- 1:10
Filter 3-dim array of numeric data (main)
Description
Filtering of matrix or array x (may be 3-dim array) according to fiTy and checkVa
Usage
.filterSw(x, fiTy, checkVa, indexRet = TRUE)
Arguments
x |
array (3-dim) of numeric data |
fiTy |
(character) which type of testing to perform ('eq','inf','infeq','sup','supeq', '>', '<', '>=', '<=', '==') |
checkVa |
(logical) s |
indexRet |
(logical) if |
Value
This function returns either index (position within 'x') or concrete (filtered) result
See Also
filt3dimArr; filterList; filterLiColDeList;
Examples
arr1 <- array(11:34, dim=c(4,3,2), dimnames=list(c(LETTERS[1:4]),
paste("col",1:3,sep=""),c("ch1","ch2")))
filt3dimArr(arr1,displCrit=c("col1","col2"),filtCrit="col2",filtVal=7)
.filterSw(arr1, fiTy="inf", checkVa=7)
Find overlap instances among range of values in lines
Description
This function aims to find overlap instances among range of values in lines of 'x' (typically give just min & max)
Usage
.findBorderOverlaps(x, rmRedund = FALSE, callFrom = NULL)
Arguments
x |
(matrix of numeric values or all-numeric data.frame) main input |
rmRedund |
(logical) report overlaps only in 1st instance (will show up twice otherwise) |
callFrom |
(character) allow easier tracking of message(s) produced |
Value
This function returns a matrix with line for each overlap found, cols 'refLi' (line no), 'targLi' (line no), 'targCol' (col no)
See Also
Examples
aa <- 11:15
Get first minimum
Description
This function allows to find the first minimum of a numeric vector
Usage
.firstMin(x, positionOnly = FALSE)
Arguments
x |
(numeric vector) main input |
positionOnly |
(logical) |
Value
numeric vector
See Also
Examples
.firstMin(c(4,3:6))
fuse 2 instances of 3dim arr as mult cols in 3dim array
Description
This function allows fusing 2 instances of 3dim arr as mult cols in 3dim array (ie fuse along 2nd dim, increase cols)
Usage
.fuse2ArrBy2ndDim(arr1, arr2, silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
arr1 |
(array) |
arr2 |
(array) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This functuin returns a numeric vector with numer of non-numeric characters (ie not '.' or 0-9))
See Also
Examples
aa <- 11:15
Get A value for each group of replicates
Description
This function calculates the 'A' value (ie group mean) for each group of replicates (eg for MA-plot)
Usage
.getAmean(dat, grp)
Arguments
dat |
(matrix or data.frame) main input |
grp |
(factor) grouping of replicates |
Value
This function returns a numeric vector
See Also
Examples
.getAmean(matrix(11:18, ncol=4), gl(2,2))
Get A value for each group of replicates based on comp
Description
This function calculates the 'A' value (ie group mean) for each group of replicates (eg for MA-plot)
comp is matrix telling which groups to use/compare, assuming that dat are already group-means)
Usage
.getAmean2(dat, comp)
Arguments
dat |
(matrix or data.frame) main input |
comp |
(matrix) tells which groups to use/compare, assuming that dat are already group-means) |
Value
This function returns a numeric vector
See Also
Examples
.getAmean(matrix(11:18, ncol=4), gl(2,2))
Get M value for each group of replicates based on comp
Description
This function calculates the 'M' value (ie log-ratio) for each group of replicates based on comp (eg for MA-plot)
comp is matrix telling which groups to use/compare, assuming that dat are already group-means)
Usage
.getMvalue2(dat, comp)
Arguments
dat |
(matrix or data.frame) main input |
comp |
(matrix) tells which groups to use/compare, assuming that dat are already group-means) |
Value
This function returns a numeric vector
See Also
Examples
.getAmean(matrix(11:18, ncol=4), gl(2,2))
Find Separator In Vector Of Pairwise Group-Names This function allows identifing separator used when pairwise groups are presented.
Description
Find Separator In Vector Of Pairwise Group-Names
This function allows identifing separator used when pairwise groups are presented.
Usage
.getPWseparator(
compNames,
potSep = "split1",
includeGrp = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
compNames |
(character or integer) names of pairwise combined group-names |
potSep |
(character) potential separators to be checked if occuring in |
includeGrp |
(logical) if |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
Note : Potential separators potSep to be tested must be at least 1 character long
The character '.' may used as potSep, it will be protected internally for correct results.
Note : The indexing is relative to the levels of grp, thus to sorted group-names !
Value
This function returns a character vector (length=1) of the (first) separator fitting to all data, or a list with $sep and $grpNa if includeGrp=TRUE
See Also
indexGroupsFromPW, getPWseparator, colnames of testing results from moderTestXgrp, used by replacePWseparator
Examples
.getPWseparator(compNames=c("B-C","B-D","C-D"))
Grow Tree
Description
This function allows growing tree-like structures (data.tree objects)
Usage
.growTree(tm, setX, addToObj = NULL)
Arguments
tm |
(list) main input, $disDat .. matrix with integer start & end sites for fragments; $lo (logical) which fragments may be grown; $start (integer) index for which line of $disDat to start; $it numeric version of $lo; $preN for previous tree objects towards root; $iter for iterator (starting at 1)) |
setX |
.. data.tree object (main obj from root) |
addToObj |
.. data.tree object (branch on which to add new branches/nodes) |
Value
This function returns a list
See Also
Examples
.datSlope(c(3:6))
Segment (1-dim vector) 'dat' into clusters
Description
This function allows aegmenting (1-dim vector) 'dat' into clusters. If 'automClu=TRUE ..' first try automatic clustering, if too few clusters, run km with length(dat)^0.3 clusters This function requires the package NbClust to be installed.
Usage
.insp1dimByClustering(
dat,
automClu = TRUE,
cluChar = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat |
matrix or data.frame, main input |
automClu |
(logical) run atomatic clustering |
cluChar |
(logical) to display cluster characteristics |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns clustering (class index) or (if 'cluChar'=TRUE) list with clustering and cluster-characteristics
See Also
Examples
set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10)
Inspect 'matr' and check if 1st line can be used/converted as header
Description
This function inspects 'matr' and check if 1st line can be used/converted as header. If colnames of 'matr' are either NULL or 'V1',etc the 1st row will be tested if it contains any of the elements (if not, 1st line won't be used as new colnames) If 'numericCheck'=TRUE, all columns will be tested if they can be converted to numeric
Usage
.inspectHeader(
matr,
headNames = c("Plate", "Well", "StainA"),
numericCheck = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
matr |
(matrix or data.frame) main input to be instected |
headNames |
(character) column-names t look for |
numericCheck |
(logical) allows reducing complexity by drawing for very long x or y |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a matrix vector or data.frame similar to input
See Also
head for looking at first few lines
Examples
ma1 <- matrix(letters[1:6], ncol=3, dimnames=list(NULL,c("ab","Plate","Well")))
.inspectHeader(ma1)
Refine/filter 'dat1' (1dim dataset, eg cluster) with aim of keeping center of data
Description
This function allows to refine/filter 'dat1' (1dim dataset, eg cluster) with aim of keeping center of data. It is done based on most freq class of histogramm keep/filter data if 'core' (
Usage
.keepCenter1d(
dat1,
core = NULL,
keepOnly = TRUE,
displPlot = FALSE,
silent = TRUE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat1 |
simple numeric vector |
core |
numeric vactor (betw 0 and 1) for fraction of data to keep; if null trimmedMean/max hist occurance will be used, limited within 30-70 perent; may also be 'high' or 'low' for forcing low (20-60percent) or high (75-99) percent of data to retain |
keepOnly |
(logical) |
displPlot |
(logical) show plot of hist & boundaries |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns the index of values retained or if 'keepOnly' return list with 'keep' index and 'drop' index
See Also
Examples
set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10)
Remove all columns where all data are not finite
Description
This function aims to remove all columns where all data are not finite
Usage
.keepFiniteCol(
dat,
msgStart = NULL,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat |
(matrix or data.frame) main input |
msgStart |
(character) |
silent |
(logical) suppres messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Value
This function returns a corrected matrix or data.frame
See Also
Examples
ma1 <- matrix(c(1:5, Inf), ncol=2)
.keepFiniteCol(ma1)
Check if vector may be numeric content
Description
This function allows to checking if a given vector may be numeric content
Usage
.mayBeNum(x, pattern = NULL)
Arguments
x |
(numeric vector) main input |
pattern |
(character) custom pattern to check |
Value
This functions returns a logical/boolean vector for each of the elements of 'x'
See Also
Examples
.mayBeNum(c(3:6))
Rescale respective to specific group
Description
This function allows to rescale data 'x' so that specific group 'grpNum' gets normalized to predefined value 'grpVal'. In normal case x will be multiplied by 'grpVal' and devided by value obtained from 'grpNum'. If summary of 'grpNum-positions' or 'grpVal' is 0, then grpVal will be attained by subtraction of summary & adding grpVal
Usage
.medianSpecGrp(x, grpNum, grpVal, sumMeth = "median", callFrom = NULL)
Arguments
x |
(numeric vector) main input |
grpNum |
(numeric) |
grpVal |
(numeric) |
sumMeth |
(character) method for summarizing |
callFrom |
(character) allow easier tracking of messages produced |
Value
numeric vector
See Also
Examples
.firstMin(c(4,3:6))
Merge Multiple Matrices (main)
Description
This function allows merging of multiple matrix-like objects from an initial list.
Usage
.mergeMatrices(
inpL,
mode = "intersect",
useColumn = 1,
extrRowNames = FALSE,
na.rm = TRUE,
argL = NULL,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
inpL |
(list containing matrices or data.frames) main input (multiple matrix or data.frame objects) |
mode |
(character) allows choosing restricting to all common elements ( |
useColumn |
(integer, character or list) the column(s) to consider, may be |
extrRowNames |
(logical) decide whether columns with all values different (ie no replicates or max divergency) should be excluded |
na.rm |
(logical) suppress |
argL |
(list of arguments) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a matrix containing all selected columns of the input matrices to fuse
See Also
mergeMatrixList, merge, mergeMatrices for separate entries
Examples
mat1 <- matrix(11:18, ncol=2, dimnames=list(letters[3:6],LETTERS[1:2]))
find closest neighbour to numeric vector
Description
This function aims to find closest neighbour to numeric vector
Usage
.minDif(z, initOrder = TRUE, rat = TRUE)
Arguments
z |
(numeric) vector to search minimum difference |
initOrder |
(logical) return matrix so that 'x' matches exactely 2nd col of output |
rat |
(logical) express result as ratio |
Value
This function returns a matrix with index,value,dif,best
See Also
Examples
.minDif(c(11:15,17))
Distances beteenw sorted points of 2-columns
Description
This function returns distances beteenw sorted points of 2-column matrix 'x'
Usage
.neigbDis(x, asSum = TRUE)
Arguments
x |
(matrix or data.frame, min 2 columns) main input |
asSum |
(logical) if |
Value
This function returns a numeric vector with distances
Examples
daPa <- matrix(c(1:5,8,2:6,9), ncol=2)
.neigbDis(daPa)
Normalize Columns Of 2-dim Matrix To Common Linear Regression Fit
Description
This function aims to normalize columns of 2dim matrix to common linear regression fit within range of 'useQuant'
Usage
.normConstSlope(
mat,
useQuant = c(0.2, 0.8),
refLines = NULL,
diagPlot = TRUE,
plotLog = "",
datName = NULL,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
mat |
matrix or data.frame of data to get normalized |
useQuant |
(numeric) quantiles to use |
refLines |
(NULL or numeric) allows to consider only specific lines of 'dat' when determining normalization factors (all data will be normalized) |
diagPlot |
(logical) draw diagnistic plot |
plotLog |
(character) indicate which axis shousl be diplayed on log-scale, may be 'x', 'xy' or 'y' |
datName |
(character) use as title in diag plot |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Value
This function returns a numeric vector
See Also
Examples
aa <- matrix(1:12, ncol=3)
Main Normalization function
Description
This function aims to normalize a matrix or data.frame by columns. It assumes all checks have been done before calling this function.
Usage
.normalize(
dat,
meth,
mode,
param,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat |
matrix or data.frame of data to get normalized |
meth |
(character) may be "mean","median","NULL","none", "standardize","trimMean", "rowNormalize", "slope", "exponent", "twoPointSlope", "vsn"; When |
mode |
(character) may be "proportional", "additive";
decide if normalizatio factors will be applies as multiplicative (proportional) or additive; for log2-omics data |
param |
(list) additional parameters |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Value
This function returns a numeric vector
See Also
Examples
aa <- matrix(1:12, ncol=3)
.normalize(aa,"median",mode="proportional",param=NULL)
Paste-concatenate all columns of matrix
Description
This function allows paste columns
Usage
.pasteCols(mat, sep = "")
Arguments
mat |
inital matrix |
sep |
(character) separator |
Value
This function returns a simplified/non-redundant vector/matrix (ie fewer lines for matrix), or respective index
See Also
unique, nonAmbiguousNum, faster than firstOfRepeated which gives more detail in output (lines/elements/indexes of omitted)
Examples
.pasteCols(matrix(11:16,ncol=2), sep="_")
Pie plot for counting results
Description
This function allows to inspect results of table or uniqCountReport on a pie-plot
Note : fairly slow for long vectors !!
Usage
.plotCountPie(
count,
tit = NULL,
col = NULL,
radius = 0.9,
sizeTo = NULL,
clockwise = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
count |
(integer vector) counting result |
tit |
(character) optional title in plot |
col |
(character) custom colors in pie |
radius |
(numeric) radius passed to |
sizeTo |
(numeric or charcter) optional reference group for size-population relative adjusting overall surface of pie |
clockwise |
(logical) argument passed to pie |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
vector with counts of n (total), nUnique (wo any repeated), nHasRepeated (first of repeated), nRedundant), optional figure
See Also
uniqCountReport, correctToUnique, unique
Examples
.plotCountPie(table(c(1:5,4:2)))
Add lower caps to character vector
Description
This function allows adding all content as lower caps to/of character vector
Usage
.plusLowerCaps(x)
Arguments
x |
(character) main input |
Value
This function returns a elongated character vector
See Also
Examples
.plusLowerCaps(c("Abc","BCD"))
Calculate residues of (2-dim) linear model 'lMod'-prediction of/for 'dat'
Description
This function calculates residues of (2-dim) linear model 'lMod'-prediction of/for 'dat' (using 2nd col of 'useCol' ) (indexing in 'dat', matrix or data.frame with min 2 cols), using 1st col of 'useCol' as 'x'. It may be used for comparing/identifying data close to regression (eg re-finding data on autoregression line in FT-ICR)
Usage
.predRes(dat, lMod, regTy = "lin", useCol = 1:2)
Arguments
dat |
matrix or data.frame, main input |
lMod |
linear model, only used to extract coefficients offset & slope |
regTy |
(character) type of regression model |
useCol |
(integer) columns to use |
Value
This function returns a numeric vector of residues (for each line of dat)
See Also
Examples
set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10)
Raise all values close to lowest value
Description
This function aims to raise all values close to lowest value to end up as at value of 'raiseTo'. This is done independently for each col of mat. This function sets all data to common raiseTo (which is min among all cols)
Usage
.raiseColLowest(
mat,
raiseTo = NULL,
minFa = 0.1,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
mat |
(matrix of numeric values) main input |
raiseTo |
(numeric) |
minFa |
(numeric) minimum factor |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of message(s) produced |
Value
This function returns a numeric vector with numer of non-numeric characters (ie not '.' or 0-9))
See Also
Examples
aa <- 11:15
Remove columns indicated by col-number
Description
This function aims to remove columns indicated by col-number
Usage
.removeCol(matr, rmCol)
Arguments
matr |
(matrix or data.frame) main input |
rmCol |
(integer) column index for removing |
Value
This function returns an matrix or data.frame
See Also
Examples
aa <- matrix(1:6, ncol=3)
.removeCol(aa, 2)
Search for (empty) columns conaining only entries defined in 'searchFields' and remove such columns
Description
This function aims to search for (empty) columns conaining only entries defined in 'searchFields' and remove such columns. If 'fromBackOnly' =TRUE .. only tailing empty columns will be removed (other columns with "empty" entries in middle will be kept). If ”=TRUE columns containing all NAs will be excluded as well This function will also remove columns containing (exculsively) mixtures of the various 'searchFields'.
Usage
.removeEmptyCol(
dat,
fromBackOnly = TRUE,
searchFields = c("", " ", "NA.", NA),
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat |
(matrix or data.frame) main input |
fromBackOnly |
(logical) |
searchFields |
(character) |
silent |
(logical) suppres messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Value
This function returns a corrected matrix or data.frame
See Also
Examples
ma1 <- matrix(c(1:5, NA), ncol=2)
.removeEmptyCol(ma1)
Replace Special Characters
Description
This function allows replacing special characters
Note that (most) special characters must be presented with protection for grep and sub.
Usage
.replSpecChar(x, findSp = c("\\(", "\\)", "\\$"), replBy = "_")
Arguments
x |
(character) main input |
findSp |
(character) special characters to replace (may have to be given as protected) |
replBy |
(character) replace by |
Value
This function returns a corrceted/adjusted factor
See Also
Examples
.replSpecChar(c("jhjh(ab)","abc"))
Trim character string: keep only text before 'sep'
Description
This functions trims character strings: It keeps only text before 'sep' (length=1 !)
Usage
.retain1stPart(chr, sep = " = ", offSet = 1)
Arguments
chr |
character vector to be treated |
sep |
(character) saparator |
offSet |
(integer) off-set |
Value
This function returns a modified character vector
See Also
Examples
.retain1stPart("abc = def")
row group CV (main)
Description
This function calculates CVs for matrix with multiple groups of data, ie one CV for each group of data.
Usage
.rowGrpCV(x, grp, means)
Arguments
x |
numeric matrix where relplicates are organized into separate columns |
grp |
(factor) defining which columns should be grouped (considered as replicates) |
means |
(numeric) alternative values instead of means by .rowGrpMeans() |
Value
This function returns a matrix of CV values
See Also
rowGrpCV, rowCVs, arrayCV, replPlateCV
Examples
set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10)
grp1 <- gl(4,3,labels=LETTERS[1:4])[2:11]
head(.rowGrpCV(dat1, grp1, .rowGrpMeans(dat1, grp1)))
row group mean (main)
Description
This function calculates CVs for matrix with multiple groups of data, ie one CV for each group of data.
Usage
.rowGrpMeans(x, grp, na.replVa = NULL, na.rm = TRUE)
Arguments
x |
numeric matrix where relplicates are organized into separate columns |
grp |
(factor) defining which columns should be grouped (considered as replicates) |
na.replVa |
(numeric) value to replace |
na.rm |
(logical) remove all |
Value
This function returns a matrix of mean values per row and group of replicates
See Also
rowGrpCV, rowCVs, arrayCV, replPlateCV
Examples
set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10)
grp1 <- gl(4,3,labels=LETTERS[1:4])[2:11]
head(.rowGrpMeans(dat1, grp1))
row group sd (main)
Description
This function calculates sd for matrix with multiple groups of data, ie one sd for each group of data.
Usage
.rowGrpSds(x, grp)
Arguments
x |
numeric matrix where relplicates are organized into separate columns |
grp |
(factor) defining which columns should be grouped (considered as replicates) |
Value
This function returns a matrix of sd values per row and group of replicates
See Also
rowGrpCV, rowCVs, arrayCV, replPlateCV
Examples
set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10)
grp1 <- gl(4,3,labels=LETTERS[1:4])[2:11]
head(.rowGrpSds(dat1, grp1))
row group rowSums per group (main)
Description
This function calculates row-sums for matrix with multiple groups of data, with multiple groups of data, ie one sd for each group of data.
Usage
.rowGrpSums(x, grp, na.replVa = NULL, na.rm = TRUE)
Arguments
x |
numeric matrix where relplicates are organized into separate columns |
grp |
(factor) defining which columns should be grouped (considered as replicates) |
na.replVa |
(numeric) value to replace |
na.rm |
(logical) remove all |
Value
This function returns a matrix of row-sums for matrix with multiple groups of data
See Also
rowGrpCV, rowCVs, arrayCV, replPlateCV
Examples
set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10)
grp1 <- gl(4,3,labels=LETTERS[1:4])[2:11]
head(.rowGrpSums(dat1, grp1))
Row-normalization Procedure On Matrix Or Data.frame (main)
Description
This function performs a row-normalization procedure on matrix or data.frame 'dat'
Usage
.rowNorm(
dat,
refLi,
method,
proportMode,
maxFact = 10,
fact0val = 10,
retFact = FALSE,
debug = FALSE,
silent = FALSE,
callFrom = NULL
)
Arguments
dat |
(matrix) .. init data, smay be parse matrix with numerous NA |
refLi |
(NULL or numeric) allows to consider only specific lines of 'dat' when determining normalization factors (all data will be normalized) |
method |
(character) may be "mean","median" (plus "NULL","none"); When NULL or 'none' is chosen the input will be returned as is |
proportMode |
(logical) decide if normalization should be done by multiplicative or additive factor |
maxFact |
(numeric, length=2) max normalization factor |
fact0val |
(integer) |
retFact |
(logical) |
debug |
(logical) additional messages for debugging |
silent |
(logical) suppress messages |
callFrom |
(character) This function allows easier tracking of messages produced |
Value
This function returns a matrix of normalized data same dimensions as 'dat'
See Also
Examples
.rowNorm(matrix(11:31, ncol=3), refLi=1, method="mean", proportMode=TRUE)
Obtain Normalization Factor (main)
Description
This function was designed to obtain normalization factors.
Usage
.rowNormFact(
dat,
combOfN,
comUse,
method = "median",
refLi = NULL,
refGrp = NULL,
proportMode = TRUE,
minQuant = NULL,
maxFact = 10,
omitNonAlignable = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat |
(matrix) .. init data, smay be parse matrix with numerous NA |
combOfN |
(matrix) .. # matrix of index for all sub-groups (assumed as sorted) |
comUse |
(list) .. index of complete lines for each col of combOfN |
method |
(character) may be "mean","median" (plus "NULL","none"); When NULL or 'none' is chosen the input will be returned as is |
refLi |
(NULL or numeric) allows to consider only specific lines of 'dat' when determining normalization factors (all data will be normalized) |
refGrp |
(integer) Only the columns indicated will be used as reference, default all columns (integer or colnames) |
proportMode |
(logical) decide if normalization should be done by multiplicative or additive factor |
minQuant |
(numeric) optional filter to set all values below given value as |
maxFact |
(numeric, length=2) max normalization factor |
omitNonAlignable |
(logical) allow omitting all columns which can't get aligned due to sparseness |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) This function allows easier tracking of messages produced |
Value
This function returns a matrix of column-indexes complementing (nCombin rows)
See Also
Examples
ma1 <- matrix(11:41, ncol=3)
Scale between 0 and 1 (main)
Description
This function rescales between 0 and 1
Usage
.scale01(x)
Arguments
x |
numeric vector to be re-scaled |
Value
This function returns a numeric vector of same length with re-scaled values
See Also
Examples
.scale01(11:15)
Rescale respective to specific group
Description
This function allows to rescale data 'x' so that 2 specific groups get normalized to predefined values (and all other values follow proportionally) 'grp1Num' and 'grp2Num' should be either numeric for positions in 'x' or character for names of 'x'; if 'grp1Num' and/or 'grp2Num' design mulitple locations: perform median or mean summarization, according to 'sumMeth'
Usage
.scaleSpecGrp(
x,
grp1Num,
grp1Val,
grp2Num = NULL,
grp2Val = NULL,
sumMeth = "mean",
callFrom = NULL
)
Arguments
x |
(numeric vector) main input |
grp1Num |
(numeric) |
grp1Val |
(numeric) |
grp2Num |
(numeric) |
grp2Val |
(numeric) |
sumMeth |
(character) method for summarizing |
callFrom |
(character) allow easier tracking of messages produced |
Value
numeric vector
See Also
Examples
.firstMin(c(4,3:6))
Scale between min and max value (main)
Description
This function rescales between user-defined min and max values
Usage
.scaleXY(x, minim = 2, maxim = 3)
Arguments
x |
numeric vector to be re-scaled |
minim |
(numeric) minimum value for resultant vactor |
maxim |
(numeric) minimum value for resultant vactor |
Value
This function returns a matrix of CV values
See Also
Examples
.scaleXY(11:15, min=1, max=100)
Cut string to get all variants from given start with min length, depreciated
Description
This function is depreciated, please use /cutStr instead !
This function allows truncating character vector to all variants from given start, with min and optonal max length
Used to evaluate argument calls without giving full length of argument
Usage
.seqCutStr(txt, startFr = 1, minLe = 1, reverse = TRUE)
Arguments
txt |
(character) main input, may be length >1 |
startFr |
(interger) where to start |
minLe |
(interger) minimum length of output |
reverse |
(logical) return longest text-fragments at beginning of vector |
Value
This function returns a character vector
See Also
Examples
.seqCutStr("abcdefg", minLe=2)
Set lowest value to given value
Description
This function aims to set lowest value of x to value 'setTo'
Usage
.setLowestTo(x, setTo)
Arguments
x |
(numeric) main vector to be treated |
setTo |
(numeric) replacement value |
Value
This function returns a numeric vector
See Also
Examples
.setLowestTo(9:4, 6)
Choose most frequent or middle of sorted vector
Description
This function chooses the (first) most frequent or middle of sorted vector, similar to the concept of mode
Usage
.sortMid(x, retVal = TRUE)
Arguments
x |
(numeric) main input |
retVal |
(logical) return value of most frequent, if |
Value
This function returns a numeric verctor
See Also
simple/partial functionality in summarizeCols, checkSimValueInSer
Examples
.sortMid(11:14)
.sortMid(rep("b",3))
Reorganize array by reducing dimension 'byDim' (similar to stack() for data-frames)
Description
This function aims to reorganize an array by reducing dimension 'byDim' (similar to stack() for data-frames) It returns an array/matrix of 1 dimension less than 'arr', 1st dim has more lines (names as paste with '_')
Usage
.stackArray(arr, byDim = 3)
Arguments
arr |
(array) main input |
byDim |
(integer) |
Value
This function returns an array/matrix of 1 dimension less than 'arr', 1st dim has more lines (names as paste with '_')
See Also
Examples
(arr1 <- array(11:37, dim=c(3,3,3)))
.stackArray(arr1, 3)
Summarize columns of matrix (or data.frame) 'x' using apply (main)
Description
This function summarizes columns of matrix (or data.frame) 'x' using apply In case of character entries the 'median' of sorted values will be returned
Usage
.summarizeCols(
x,
me = "median",
nEq = FALSE,
vectAs1row = TRUE,
supl = NULL,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
data.frame matrix of data to be summarized by comlumn |
me |
(character, length=1) summarization method (eg 'min','max','mean','mean.trim','median','sd','CV', 'medianComplete' or 'meanComplete' etc, see |
nEq |
(logical) if TRUE, add additional column indicating the number of equal lines for choice (only with min or max) |
vectAs1row |
(logical) if TRUE will interprete non-matrix 'x' as matrix with 1 row (correct effect of automatic conversion when extracting 1 line) |
supl |
(numeric) supplemental parameters for the various summarizing functions (currently used with 'me=mean.trim' to assign upper and lower trimming fraction, passed to ) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
vector with summary for each column (unless 'me=="summary"', in this case a matrix or list will be returned )
See Also
Examples
m1 <- matrix(c(28,27,11,12,11,12), nrow=2, dimnames=list(1:2,c("y","x","ref")))
.summarizeCols(m1, me="median")
Trim from end (Deprecated)
Description
Deprecated Version - This function allows trimming/removing redundant text-fragments from end
Usage
.trimFromEnd(x, ..., callFrom = NULL, debug = FALSE, silent = TRUE)
Arguments
x |
character vector to be treated |
... |
more vectors to be treated |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) display additional messages for debugging |
silent |
(logical) suppress messages |
Value
This function returns a modified character vector
See Also
trimRedundText; Inverse : Find/keep common text keepCommonText; you may also look for related functions in package stringr
Examples
txt1 <- c("abcd_ccc","bcd_ccc","cde_ccc")
.trimRight(txt1)
Trim from start (Deprecated)
Description
Deprecated Version - This function allows trimming/removing redundant text-fragments from start
Usage
.trimFromStart(
x,
...,
minNchar = 1,
silent = TRUE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
character vector to be treated |
... |
more vectors to be treated |
minNchar |
(integer) minumin number of characters that must remain |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a modified character vector
See Also
trimRedundText; Inverse : Find/keep common text keepCommonText; you may also look for related functions in package stringr
Examples
txt1 <- c("abcd_ccc","bcd_ccc","cde_ccc")
.trimLeft(txt1) # replacement
Trim From Left Side
Description
This function allows trimming/removing redundant text-fragments from left side.
Usage
.trimLeft(x, minNchar = 1, silent = TRUE, debug = FALSE, callFrom = NULL)
Arguments
x |
character vector to be treated |
minNchar |
(integer) minumin number of characters that must remain |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a modified character vector
See Also
trimRedundText; Inverse : Find/keep common text keepCommonText; you may also look for related functions in package stringr
Examples
txt1 <- c("abcd_ccc","bcd_ccc","cde_ccc")
.trimLeft(txt1)
Trim From Right Side
Description
This function allows trimming/removing redundant text-fragments from right side.
Usage
.trimRight(x, minNchar = 1, silent = TRUE, debug = FALSE, callFrom = NULL)
Arguments
x |
character vector to be treated |
minNchar |
(integer) minumin number of characters that must remain |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a modified character vector
See Also
trimRedundText; Inverse : Find/keep common text keepCommonText; you may also look for related functions in package stringr
Examples
txt1 <- c("abcd_ccc","bcd_ccc","cde_ccc")
.trimRight(txt1)
Check regression arguments
Description
This function is an enhanced version of unique, names of elements are maintained
Usage
.uniqueWName(
x,
splitSameName = TRUE,
silent = TRUE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
(numeric or character vector) main input |
splitSameName |
(logical) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
vector like input
See Also
Examples
aa <- c(a=11, b=12,a=11,d=14, c=11)
.uniqueWName(aa)
.uniqueWName(aa[-1]) # value repeated but different name
Convert numeric vector to matrix
Description
Take (numeric) vector and return matrix, if 'colNa' given will be used as colname
Usage
.vector2Matr(x, colNa = NULL, rowsKeep = TRUE)
Arguments
x |
(numeric or character) main input |
colNa |
(integer) design the comumn-name to be given |
rowsKeep |
(logical) is |
Value
matrix
See Also
Examples
.vector2Matr(c(3:6))
Express difference as ppm
Description
This function transforms offset (pariwise-difference) between 'x' & 'y' to ppm (as normalized difference ppm, parts per million, ie (x-y)/y ). This type of expressiong differences is used eg in mass-spectrometry.
Usage
XYToDiffPpm(x, y, nSign = NULL, silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
x |
(numeric) typically for measured variable |
y |
(numeric) typically for theoretical/expected value (vector must be of same length as 'x') |
nSign |
(integer) number of significant digits in output |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a numeric vector of (ratio-) ppm values
See Also
ratioToPpm for classical ppm
Examples
set.seed(2017); aa <- runif(10,50,900)
cbind(x=aa,y=aa+1e-3,ppm=XYToDiffPpm(aa,aa+1e-3,nSign=4))
Add Text Before File-Extension
Description
This function helps changing character strings like file-names and allows adding the character vector 'add' (length 1) before the extension (defined by last '.') of the input string 'x'. Used for easily creating variants/additional filenames but keeping current extension.
Usage
addBeforFileExtension(
x,
add,
sep = "_",
silent = FALSE,
callFrom = NULL,
debug = FALSE
)
Arguments
x |
main character vector of file-names |
add |
character vector to be added |
sep |
(character) separator between 'x' & 'add' (character, length 1) |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) additional messages for debugging |
Details
This function will get deprecated and is replaced by addBeforeFileExtension (to correct a typo in the name of this function).
Value
modified character vector
Examples
addBeforFileExtension(c("abd.txt","ghg.ijij.txt","kjh"), "new")
Add Text Before File-Extension
Description
This function helps changing character strings like file-names and allows adding the character vector 'add' (length 1) before the extension (defined by last '.') of the input string 'x'. Used for easily creating variants/additional filenames but keeping current extension.
Usage
addBeforeFileExtension(
x,
add,
sep = "_",
silent = FALSE,
callFrom = NULL,
debug = FALSE
)
Arguments
x |
main character vector of file-names |
add |
character vector to be added |
sep |
(character) separator between 'x' & 'add' (character, length 1) |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) additional messages for debugging |
Details
Since this function replaces the deprecated addBeforFileExtension (to correct a typo in the name of the old version of the function).
Value
modified character vector
Examples
addBeforeFileExtension(c("abd.txt","ghg.ijij.txt","kjh"),"new")
Adjust Values By Two-Point Regression
Description
This function performs linear rescaling of numeric data based on specified limits (ie a specified window). Values are adjusted to fit within a target range defined by 'regrTo'.
Usage
adjBy2ptReg(
dat,
lims,
regrTo = c(0.1, 0.9),
refLines = NULL,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat |
A numeric vector or matrix of values to adjust. |
lims |
A list of two numeric vectors, each of length 1 or 2, representing the lower and upper limits for rescaling. Example: 'lims = list(c(5, 9), c(60, 90))'. |
regrTo |
A numeric vector of length 2 defining the target range for rescaling (default: 'c(0.1, 0.9)'). |
refLines |
Optional numeric or character vector specifying reference lines (rows) in 'dat' to use for rescaling. If 'NULL', all rows are used. |
silent |
Logical. If 'TRUE', suppresses messages (default: 'FALSE'). |
debug |
Logical. If 'TRUE', prints debugging messages (default: 'FALSE'). |
callFrom |
Character string for tracking messages (default: 'NULL'). |
Details
Since this function shares sigificant overlap with scaleXY (which has more advanced options) it is rather suggested to use _scaleXY()_ instead.
The function _adjBy2ptReg()_ will may deprecated in the future.
Value
A numeric vector or matrix with adjusted values.
Examples
set.seed(2016); dat1 <- round(runif(50, 0, 100), 1)
adjBy2ptReg(dat1, lims = list(c(5, 9), c(60, 90)))
plot(dat1, adjBy2ptReg(dat1, lims=list(c(5,9), c(60,90))))
Adjust Value With Different Decimal Prefixes To Single Prefix Plus Unit
Description
This function provides help converting values with with different unit-prefixes to a single prefix-unit type. This can be used to convert a vector of mixed prefixes like 'p' and 'n'. Any text to the right of the unit will be ignored.
Usage
adjustUnitPrefix(
x,
pref = c("z", "a", "f", "p", "n", "u", "m", "", "k", "M", "G"),
unit = "sec",
sep = c("_", ".", " ", ""),
minTrimNChar = 0,
returnType = c("NAifInvalid", "allText"),
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
(character) vector containing digit uunit-prefix and unit terms |
pref |
(character) multiplicative unit-prefixes, assumes as increasing factors of 1000 |
unit |
(character) unit name, the numeric part may be sepatated by one space-character |
sep |
(character) separator characters that may appear between integer numeric value and unit description |
minTrimNChar |
(integer) min number of text characters when trimming adjacent text on left and right of main numeric+prefix+unit |
returnType |
(character) set options for retuning results : 'NAifInvalid' .. return NA for invalid parts,'allText' .. return initial text if problem, 'trim' |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
The aim of this function if to allow adjusting a vector containing '100pMol' and '1nMol' to '100pMol' and '1000pMol' for better downstream analysis.
Please note that the current version recognizes and converts only interger values; decimals or scientific writing won't be recognized properly.
The resultant numeric vector expresses all values as lowest prefix unit level.
In case of invalid entries NAs will be returned.
Please note that decimal/comma digits will not be recognized properly, since the function will consider (by default) the decimal sign as just another separator.
To avoid special characters (which may not work on all operating-systems) the letter 'u' is used for 'micro'.
Value
This function returns a character vector (same length as input) with adjusted unified decimal prefix and adjusted numeric content, the numeric content only is also giben in the names of the output
See Also
convToNum; checkUnitPrefix; trimRedundText
Examples
adjustUnitPrefix(c("2.psec abc","20 fsec etc"), unit="sec")
x1 <- c("50_amol", "5_fmol","250_amol","100_amol", NA, "500_amol", "500_amol", "1_fmol")
adjustUnitPrefix(x1, unit="mol")
x2 <- c("abCc 500_nmol ABC", "abEe5_umol", "", "abFF_100_nmol_G", "abGg 2_mol", "abH.1 mmol")
rbind( adjustUnitPrefix(x2, unit="mol", returnType="allText") ,
adjustUnitPrefix(x2, unit="mol", returnType="trim"),
adjustUnitPrefix(x2, unit="mol", returnType=""))
Append vectors or lists, without duplcating common elements
Description
This function allows combining two vectors or lists without duplicating common content (definded by name of list-elements).
Usage
appendNR(
x,
y,
rmDuplicate = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
(vector or list) must have names to allow checking for duplicate names in y |
y |
(vector or list) must have names to allow checking for duplicate names in x |
rmDuplicate |
(logical) avoid duplicating liste-elements present in both x and y (based on names of list-elements) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of message(s) produced |
Details
When setting the argument rmDuplicate=FALSE the function will behave like append.
Value
If both x and y are vectors, the output will be a vector, otherwise it will be a list
See Also
Examples
li1 <- list(a=1, b=2, c=3)
li2 <- list(A=11, B=12, c=3)
appendNR(li1, li2)
append(li1, li2)
CV of array
Description
arrayCV gets CVs for replicates in 2 or 3 dim array and returns CVs as matrix.
This function may be used to calculate CVs from replicate microtiter plates (eg 8x12) where replicates are typically done as multiple plates,
ie initial matrixes that are the organized into arrays.
Usage
arrayCV(arr, byDim = 3, silent = TRUE, callFrom = NULL)
Arguments
arr |
(3-dim) array of numeric data like where replicates are along one dimesion of the array |
byDim |
(integer) over which dimension repliates are found |
silent |
(logical) suppres messages |
callFrom |
(character) allow easier tracking of message produced |
Value
matrix of CV values
See Also
Examples
set.seed(2016); dat1 <- matrix(c(runif(200) +rep(1:10,20)), ncol=10)
head(arrayCV(dat1,byDim=2))
Organize Data As Separate List-Entries
Description
asSepList allows reorganizing most types of input into a list with separate numeric vectors. For example, matrixes or data.frames will be split into separate columns
(differnt to partUnlist which maintains the original structure). This function also works with lists of lists.
This function may be helpful for reorganizing data for plots.
Usage
asSepList(
y,
minLen = 4,
asNumeric = TRUE,
exclElem = NULL,
sep = "_",
fillNames = TRUE,
silent = FALSE,
callFrom = NULL,
debug = FALSE
)
Arguments
y |
list to be separated/split in vectors |
minLen |
(integer) min length (or number of rows), as add'l element to eliminate arguments given without names when asSepList is called in vioplot2 |
asNumeric |
(logical) to transform all list-elements in simple numeric vectors (won't work if some entries are character) |
exclElem |
(character) optinal names to exclude if any (lazy matching) matches (to exclude other arguments be misinterpreted as data) |
sep |
(character) separator when combining name of list-element to colames |
fillNames |
(logical) add names for list-elements/ series when not given |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) display additional messages for debugging |
Value
This function returns a list, partially unlisted to vectors
See Also
Examples
bb <- list(fa=gl(2,2), c=31:33, L2=matrix(21:28,nc=2),
li=list(li1=11:14, li2=data.frame(41:44)))
asSepList(bb)
## multi data-frame examples
ca <- data.frame(a=11:15, b=21:25, c=31:35)
cb <- data.frame(a=51:53, b=61:63)
cc <- list(gl(3,2), ca, cb, 91:94, short=81:82, letters[1:5])
asSepList(cc)
cd <- list(e1=gl(3,2), e2=ca, e3=cb, e4=91:94, short=81:82, e6=letters[1:5])
asSepList(cd)
Normalize Blockwise Two Or Three Datasets
Description
This function provides for normalizing 2 entire data-sets against each other while preserving each set's characteristics. Several methods are possible: normalize blocks to common range, blocks to common median, to common distribution per block (quantile-normalization)
Usage
blockNormalize(
x,
y,
z = NULL,
method = "quantile.block",
range = c(0, 1),
q = c(0, 1),
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
(matrix or data.frame) first data-set (must be at least 2 columns and 3 lines) |
y |
(matrix or data.frame) second data-set (must be at least 2 columns and 3 lines) |
z |
( |
method |
Character string or function specifying the normalization method: - '"quantile.block"' (default): Aligns the distributions of all input datasets to a **common target distribution** (the mean of sorted values at each quantile). After normalization, 'sort(x)', 'sort(y)', and 'sort(z)' (if provided) are **identical**. This is useful for making datasets directly comparable. - '"rescale"': Rescales each dataset **independently** to the range specified by 'range'. Preserves the shape of each distribution but standardizes the scale (e.g., to '[0, 1]'). - '"median"': This precedure works in a proportional matter. It centers each dataset by deviding by its group median and multiplying by the overall median. This removes location differences while preserving spread. - '"logMedian"': This precedure is adoped for log-data. It centers each dataset by subtracting its group-median and addding the overall median. Removes location differences while preserving spread. - '"none"': No normalization |
range |
(numeric vector, length=2) vector specifying the target values to be used in case |
q |
(numeric vector, length=2) vector specifying the quantiles to be used in case |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
Main methods for choice :
- quantile.block: This method runs a quantile-normalization on each block (but NOT on each column). Thus, all datasets will get the same (overall) distributions.
- rescale: Apply a linear transformation to each dataset to fit within given 'range'.
- median: Normalize each block to get the same overall median (individual columns may deviate, the original order is preserved).
- logMedian: This procedure is an median normalization adopted to log-data. Instead of dividing and multiplying per-group medians will be subtracted and the target median will be added.
- none: Besides, it is also possible to not do any normalization, the output will be identical to the input
NA Handling:
For all approaches NAs will get ignored.
With method='quantile.block' all precise positions where there is an NA in any of the data x, y or z will be ignored to
maintain equal numbers of data.
This is due to the fact that regular quantile-normalization requires equal numbers of data per column
(here one dataset is treated like a column in regular normalization).
This means that the dataset with the highest number of NAs will indirectly has the capacity
to mask valid data in other data-sets.
Value
This function returns a list of the normalized sets for x and y (and z if given)
See Also
normalizeThis for normalizing all columns of single data-set, quantile, scale for standard scaling
Examples
## Basic usage with vectors
x <- c(1, 5, 3, 7, 2)
y <- c(10, 20, 30, 40, 50)
## Align distributions (default: x and y will have identical distributions)
norm1 <- blockNormalize(x, y)
table(sort(norm1$x) == sort(norm1$y)) # all TRUE with 'quantile.block'
## matrix-example (like with omics-data)
set.seed(2026); mat1 <- matrix(rnorm(70), nrow=10) *5 # 10 lines x 10 samples
set.seed(2025); mat2 <- matrix(rnorm(70, mean=5), nrow=10)^2 -15
mat2[which(mat2 < 1.8)] <- mat2[which(mat2 < 1.8)] + 32
norm2 <- blockNormalize(mat1, mat2, method="rescale", range=c(0.1, 10))
sapply(norm2, range)
norm3 <- blockNormalize(mat1, mat2, method="median")
sapply(norm3, quantile, c(0.25,0.5,0.75), na.rm=TRUE)
norm4 <- blockNormalize(mat1, mat2, method="quantile.block")
sapply(norm4, quantile, c(0.25,0.5,0.75), na.rm=TRUE)
## the resulting distribution
layout(matrix(1:4, ncol=2))
boxplot(cbind(mat1, NA, mat2), main="initial", las=1)
boxplot(cbind(norm2$x, NA, norm2$y), main="rescale block", las=1)
boxplot(cbind(norm3$x, NA, norm3$y), main="median block", las=1)
boxplot(cbind(norm4$x, NA, norm4$y), main="quantile.block", las=1)
## the overall distribution of blocks
layout(matrix(1:4, ncol=2))
boxplot(cbind(mat1=as.numeric(mat1), mat2=as.numeric(mat2)), main="initial (overall)",las=1)
boxplot(cbind(mat1=as.numeric(norm2$x), mat2=as.numeric(norm2$x)),
main="rescale block norm (overall)",las=1)
boxplot(cbind(mat1=as.numeric(norm3$x), mat2=as.numeric(norm3$x)),
main="median block norm (overall)",las=1)
boxplot(cbind(mat1=as.numeric(norm4$x), mat2=as.numeric(norm4$x)),
main="quantile.block norm (overall)",las=1)
Connect edges to from tree and extract all possible branches
Description
It is assumed that multiple fragments from a common ancestor bay be charcterized by the their start- and end-sites by integer values.
For example, If 'abcdefg' is the ancestor, the fragments 'bcd' (from position 2 to 4) to and 'efg' may then be assembled.
To do so, all fragments must be presented as matix specifying all start- and end-sites (and fragment-names).
buildTree searchs contiguous fragments from columns 'posCo' (start/end) from 'disDat' to build tree & extract path information starting with line 'startFr'.
Made for telling if dissociated fragments contribute to long assemblies.
This function uses various functions of package data.tree which must be installed, too.
Usage
buildTree(
disDat,
startFr = NULL,
posCo = c("beg", "end"),
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
disDat |
(matrix or data.frame) integer values with 1st column, ie start site of fragment, 2nd column as end of fragments, rownames as unique IDs (node-names) |
startFr |
(integer) index for 1st node (typically =1 if 'disDat' sorted by "beg"), should point to a terminal node for consective growing of branches |
posCo |
(character) colnames specifying the begin & start sites in 'disDat', if NULL 1st & 2nd col will be used |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a list with $paths (branches as matrix with columns 'sumLen' & 'n'), $usedNodes (character vector of all names used to build tree) and $tree (object from data.tree)
See Also
package data.tree original function used Node; in this package : for exploiting edge/tree related issues simpleFragFig, countSameStartEnd and contribToContigPerFrag,
Examples
frag2 <- cbind(beg=c(2,3,7,13,13,15,7,9,7,3,7,5,7,3),end=c(6,12,8,18,20,20,19,12,12,4,12,7,12,4))
rownames(frag2) <- c("A","E","B","C","D","F","H","G","I", "J","K","L","M","N")
buildTree(frag2)
countSameStartEnd(frag2)
cbind to non-redundant
Description
cbindNR combines all matrixes given as arguments to non-redundant column names (by ADDING the number of 'duplicated' columns !).
Thus, this function works similar to cbind, but allows combining multiple matrix-objects containing redundant column-names.
Of course, all input-matrixes must have the same number of rows !
By default, the output gets sorted by column-names.
Note, due to the use of '...' arguments must be given by their full argument-names, lazy evaluation might not recognize properly argument names.
Usage
cbindNR(
...,
convertDFtoMatr = TRUE,
sortOutput = TRUE,
summarizeAs = "sum",
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
... |
all matrixes to get combined in cbind way |
convertDFtoMatr |
(logical) decide if output should be converted to matrix |
sortOutput |
(logical) optional sorting by column-names |
summarizeAs |
(character) decide of combined values should get summed (default, 'sum') or averaged ('mean') |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a matrix or data.frame (as cbind would return)
See Also
cbind, nonAmbiguousNum, firstOfRepLines
Examples
ma1 <- matrix(1:6, ncol=3, dimnames=list(1:2,LETTERS[3:1]))
ma2 <- matrix(11:16, ncol=3, dimnames=list(1:2,LETTERS[3:5]))
cbindNR(ma1, ma2)
cbindNR(ma1, ma2, summarizeAs="mean")
Check How Multiple Groups Of Data Separate Or Overlap Based On Mean +/- Sd
Description
This function compares if/how neighbour groups separate/overlap via the 'engineering approach' (+/- 2 standard-deviations is similar to a=0.05 t.test).
This approach may be used as less elegant alternative to (multi-group) logistic regression.
The function uses 'daAv' as matrix of means (rows are tested for up/down character/progression) which get compared with boundaries taken from daSd (for Sd values of each mean in 'daAv').
Usage
checkAvSd(
daAv,
daSd,
nByGr = NULL,
multSd = 2,
codeConst = "const",
extSearch = FALSE,
outAsLogical = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
daAv |
matrix or data.frame |
daSd |
matrix or data.frame |
nByGr |
optinal specifying number of Elements per group, allows rather using SEM (adopt to variable n of different groups) |
multSd |
(numeric) the factor specifyin how many sd values should be used as margin |
codeConst |
(character) which term/word to use when specifying 'constant' |
extSearch |
(logical) if TRUE, extend search to one group further (will call result 'nearUp' or 'nearDw') |
outAsLogical |
to switch between 2col-output (separate col for 'up' and 'down') or simple categorical vector ('const','okDw','okUp') |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
The function returns a character-vector describing as 'const' or 'okUp','okDw' (or if extSearch=TRUE 'nearUp','nearDw')
See Also
Examples
mat1 <- matrix(rep(11:24,3)[1:40], byrow=TRUE,ncol=8)
checkGrpOrderSEM(mat1, grp=gl(3,3)[-1])
checkAvSd(rowGrpMeans(mat1,gl(3,3)[-1]), rowGrpSds(mat1, gl(3,3)[-1]) )
# consider variable n :
checkAvSd(rowGrpMeans(mat1,gl(3,3)[-1]),rowGrpSds(mat1,gl(3,3)[-1]),nByGr=c(2,3,3))
Verify File-name If Existing (in specified path), If Has Proper Extension Or Select Files With Proper Extension From Given Path
Description
This function allows tesing if a given file-name corresponds to an existing file (eg for reading lateron). Indications to the path and file-extensions may be given separately. If no files do match .gz compressed versions may be searched, too.
Usage
checkFilePath(
fileName = NULL,
path = "./",
expectExt = "",
mode = "compressedOption",
compressedOption = NULL,
strictExtension = NULL,
stopIfNothing = NULL,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
fileName |
(character) name of file to be tested; may also include an absolute or relative path;
if |
path |
(character, length=1) optional separate entry for path of |
expectExt |
(character) file extension (will not be considered if |
mode |
(character) further details if function should give error or warning if no files found
integrates previous argument |
compressedOption |
deprected (logical) also look for .gz compressed files |
strictExtension |
deprected (logical) decide if extesion ( |
stopIfNothing |
deprected, please use argument |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
When the filename given by the user exists but it's file-extension is not matching expectExt
the argument strictExtension allows to decide if the filename will still be returned or not.
When expectExt is given, initial search will look for perfect matches.
However, if nothing is found and strictExtension=FALSE, a more relaxed and non-case-sensitive search will be performed.
Value
This function returns a character vector with verified file-name(s) (and path), returns NULL if nothing found - unless mode="stopIfNothing"
See Also
Examples
(RhomeFi <- list.files(R.home()))
file.exists(file.path(R.home(), "bin"))
checkFilePath(c("xxx","unins000"), R.home(), expectExt="dat")
Check Order Of Groups
Description
This function tests each line of 'x' if expected order appears. Used for comparing groups of measures with expected profile (simply by mataching expected order)
Usage
checkGrpOrder(
x,
rankExp = NULL,
revRank = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
matrix or data.frame, main input |
rankExp |
(numeric) expected order for values in columns, default 'rankExp' =1:ncol(x) |
revRank |
(logical) if 'revRank'=TRUE, the initial ranks & reversed ranks will be tested |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a vector of logical values
See Also
Examples
set.seed(2005); mat1 <- rbind(matrix(round(runif(40),1),nc=4), rep(1,4))
checkGrpOrder(mat1)
checkGrpOrder(mat1,c(1,4,3,2))
Check Order Of Multiple Groups Including Non-Overlapping SEM-Margins
Description
This function tests each line of 'x' if expected order of (replicate-) groups (defined in 'grp') appears intact, while inluding SEM of groups (replicates) via a proportional weight 'sdFact' as (avGr1-gr1SEM) < (avGr1+gr1SEM) < (avGr2-gr2SEM) < (avGr2+gr2SEM).
Usage
checkGrpOrderSEM(
x,
grp,
sdFact = 1,
revRank = TRUE,
shrink1sampSd = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
matrix or data.frame |
grp |
(factor) to organize replicate columns of (x) |
sdFact |
(numeric) is proportional factor how many times the SD will be used for defining lower & upper bounds of each group (ie |
revRank |
(logical) (not implemented yet : optionally revert rank) |
shrink1sampSd |
(logical) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
This function may be used for comparing groups of measures with expected profiles (by matching expected order) to check if data in 'x' represt ascending groups ('grp') . Groups of size=1: The sd (and SEM) can't be estimated directly without any replicates, however, an estimate can be given by shrinking if 'shrink1sampSd'=TRUE under the hypothesis that the overall mechanisms determining the variances is constant across all samples.
Value
This function returns a list with $rankExp as logical vector telling if group-ranges are asending and $lims wityh the sd-based group-limits
See Also
takes only 10
Examples
mat1 <- matrix(rep(11:24,3)[1:40], byrow=TRUE, ncol=8)
dimnames(mat1) <- list(letters[1:nrow(mat1)], paste(rep(LETTERS[3:1], each=3)[-1],
rep(1:3, 3)[-1], sep="."))
checkGrpOrderSEM(mat1, grp=gl(3,3, labels=LETTERS[3:1])[-1])
Check for similar values in series
Description
This function checks all values of 'x' for similar neighbour values within (relative) range of 'ppm' (ie parts per milion as measure of distance).
By default values will be sorted internally, so if a given value of x has anywhere in x another value close enough, this will be detected.
However, if sortX=FALSE only the values next to left and right will be considered.
Return logical vector : FALSE for each entry of 'x' if value inside of ppm range to neighbour (of sorted values)
Usage
checkSimValueInSer(
x,
ppm = 5,
sortX = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
numeric vector |
ppm |
(numeric, length=1) ppm-range for considering as similar |
sortX |
(logical) allows speeding up function when set to FALSE, for large data that are already sorted |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a logical vector : TRUE for each entry of x where at least one neighbour is inside of ppm distance/range
See Also
similar with more options withinRefRange
Examples
va1 <- c(4:7,7,7,7,7,8:10)+(1:11)/28600; checkSimValueInSer(va1)
data.frame(va=sort(va1),simil=checkSimValueInSer(va1))
Check for strict (ascencing or descending) order
Description
checkStrictOrder tests lines of 'dat' (matrix of data.frame) for strict order (ascending, descending or constant),
each col of data is tested relative to the col on its left.
Usage
checkStrictOrder(
dat,
invertCount = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat |
matrix or data.frame |
invertCount |
(logical) inverse counting (ie return 0 for all elememts in order) |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
matrix with counts of up pairs, down pairs, equal-pairs, if 'invertCount'=TRUE all non-events are counted, ie a resulting 0 means that all columns are following the described characteristics (with variabale col-numbers easier to count)
See Also
Examples
set.seed(2005); mat1 <- rbind(matrix(round(runif(40),1),nc=4), rep(1,4))
checkStrictOrder(mat1); mat1[which(checkStrictOrder(mat1)[,2]==0),]
Check For Common Unit-Name in Text
Description
This function aims to find a unit abbreviation or name occurring in all elements of a character-vector x.
The unit name may be preceeded by different decimal prefixes (eg 'k','M'), as defined by argument pref and separators (sep).
The unit name will be returned (or first of multiple).
Usage
checkUnitPrefix(
x,
pref = c("a", "f", "p", "n", "u", "m", "", "k", "M", "G", "T", "P"),
unit = c("m", "s", "sec", "Mol", "mol", "g", "K", "cd", "A", "W", "Watt", "V", "Volt"),
sep = c("", " ", ";", ",", "_", "."),
sep2 = "",
stringentSearch = FALSE,
na.rm = FALSE,
protSpecChar = TRUE,
inclPat = FALSE,
callFrom = NULL,
silent = FALSE,
debug = FALSE
)
Arguments
x |
(character) vector containing digit uunit-prefix and unit terms |
pref |
(character) multiplicative unit-prefixes, assumes as increasing factors of 1000 |
unit |
(character) unit name, the numeric part may be sepatated by one space-character |
sep |
(character) separator character(s) that may appear between integer numeric value and unit-prefix |
sep2 |
(character) separator character(s) after |
stringentSearch |
(logical) if |
na.rm |
(logical) remove |
protSpecChar |
(logical) protect special characters and use as they are instead of regex-meaning |
inclPat |
(logical) return list including pattern of successful search |
callFrom |
(character) allow easier tracking of messages produced |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
Details
Basically this function searches the pattern : digit + separator(sep) + prefix(pref) + unit + optional separator2(sep2)
and returns the first unit-name/abbreviation found in all elements of x.
If if()
In case of invalid entries or no common unit-names NULL will be returned.
Please note the 'u' is used for 'micro' since handeling of special characters may not be portal between different operating systems.
Value
This function returns a charcter vector (length=1) with the common unit name, if inclPat=TRUE it returns a list with $unit and $pattern
See Also
Examples
x1 <- c("10fg WW","xx 10fg 3pW"," 1pg 2.0W")
checkUnitPrefix(x1)
## different separators between digit and prefix:
x2 <- c("10fg WW","xx 8_fg 3pW"," 1 pg-2.0W")
checkUnitPrefix(x2, stringentSearch=TRUE)
checkUnitPrefix(x2, stringentSearch=FALSE)
x4 <- c("CT_mixture_QY_50_amol_CN_UPS1_CV_Standards_Research_Group",
"CT_mixture_QY_5_fmol_CN_UPS1_CV_Standards_Research_Group")
Check length of vector
Description
checkVectLength checks argument 'x' for expected length 'expeL' and return either message or error when expectation not met.
May be used for parameter ('sanity') checking in other user front-end functions.
Usage
checkVectLength(
x,
expeL = 1,
stopOnProblem = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
(numeric or charcter vector) input to check length |
expeL |
(numeric) expected length |
stopOnProblem |
(logical) continue on problems with message or stop (as error message) |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of message(s) produced |
Value
This function returns NULL; it produces either error-message if length is not OK or optional message if length is OK
Examples
aa <- 1:5; checkVectLength(aa,exp=3)
Choose Column Most Likely For Sample-Names
Description
This function looks at all comumns of mat which columns may be likely choices for sample-names and derives then group-names after stripping terminal enumerators.
Ideal sample-names should contain some replicates indicates as terminal enumerators.
Usage
chooseGroupNames(
mat,
useCoNa = NULL,
method = "median",
sep = c("_", "-", " ", ".", "=", ";"),
rmTxt = NULL,
asUnique = TRUE,
partEnumerator = FALSE,
fullReport = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
mat |
(matrix or data.frame) contains possible choices for sample-names |
useCoNa |
(character) optional custom choice for columns of |
method |
(character) decide how to choose number of groups as : min, low, med, high, max or mode
Note arguments |
sep |
(character) separators considered when searching and removing common words |
rmTxt |
(character, length=1) optional removing of custom text (eg variable file-extensions); no obligation that |
asUnique |
(logical) requires all (potential) samples-names to be unique (ie no repeats) to be considered for group-names; also removes all candidate columns with all different names |
partEnumerator |
(logical) when |
fullReport |
(logical) if |
silent |
(logical) suppress messages if |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Details
The basic idea is that the column containing (good) samples-names contains all different entries and that by stripping terminal enumerators one can understand the grouping of replicates.
Note arguments asUnique and partEnumerator influence which columns of mat will be evaluated/checked
Value
This function returns a character vector with grouop-names (and sample-names as names of entries) or
if fullReport=TRUE a list with $group, $sampleNames, $col (index of column from mat and name of column
See Also
rmSharedWords, replicateStructure, protectSpecChar
Examples
mat <- cbind(a=letters[1:6], b=paste(rep(c("b","B"), each=3), 1:3), c=rep(1,6),
d=gl(3,2), e=rep(c("e","E"),3), f=paste(rep(c("F","f","ff"), each=2), 1:2))
chooseGroupNames(mat, method="median") # col 2 (b/B)
chooseGroupNames(mat, method="median", fullReport=TRUE)
chooseGroupNames(mat, method="min") # col 2 (b/B)
chooseGroupNames(mat, method="max") # col 6 (F/f/ff)
chooseGroupNames(mat, method="max", asUnique=FALSE) # col 1 (a..)
Replace Most Distant Values by NA
Description
This procedures aims to streighten (clean) the most extreme values of noisy replicates by identifying the most distant points (among a set of replicates). The input 'x' (matrix or data.frame) is supposed to come from multiple different measures taken in replicates (eg weight of different individuals as rows taken as multiple replicate measures in subsequent columns).
Usage
cleanReplicates(
x,
centrMeth = "median",
nOutl = 2,
retOffPos = FALSE,
silent = FALSE,
callFrom = NULL
)
Arguments
x |
matrix (or data.frame) |
centrMeth |
(character) method to summarize (mean or median) |
nOutl |
(integer) determines how many points per line will be set to |
retOffPos |
(logical) if |
silent |
(logical) suppres messages |
callFrom |
(character) allow easier tracking of messages produced |
Details
With the argument nOutl the user chooses the total number of most extreme values to replace by NA.
how many of the most extreme replicates of the whole dataset will replaced by NA, ie with nOutl=1
only the single most extreme outlyer will be replaced by NA.
Outlier points are determined as point(s) with highest distance to (row) center (median and mean choice via argument 'centrMeth').
Thus function returns input data with "removed" points set to NA, or if retOffPos=TRUE the most extreme/outlier positions.
Value
This function returns a matrix of same dimensions as input x, data-points which were tagged/removed are set to NA, or if retOffPos=TRUE the most extreme/outlier positions
Examples
mat3 <- matrix(c(19,20,30, 18,19,28, 16,14,35),ncol=3)
cleanReplicates(mat3, nOutl=1)
Reorganize Results Of Search For Close (Similar) Values In Matrix-view
Description
This function reorganizes/refines results from simple search of similar values of 2 sets of data by findCloseMatch (as list for one-to many relations) to more human friendly/readable matrix.
This function returns results combining two sets of data which were initially compared (eg measured and threoretical values) as matrix-view using output of findCloseMatch and both original datastes
Usage
closeMatchMatrix(
closeMatch,
predMatr,
measMatr,
prefMatch = c("^x", "^y"),
colPred = 1,
colMeas = 1,
limitToBest = TRUE,
asDataFrame = FALSE,
origNa = TRUE,
silent = FALSE,
callFrom = NULL,
debug = FALSE
)
Arguments
closeMatch |
(list) output from |
predMatr |
(vector or matrix) predicted values, the column 'colPred' indicates which column is used for matching from |
measMatr |
(vector or matrix) measured values, the column 'colMeas' indicates which column is used for matching from |
prefMatch |
(character, length=2) prefixes ('^x' and/or '^y') thay may have been added by |
colPred |
(integer or text, length=1) column of 'predMatr' with main values of comparison |
colMeas |
(integer or text, length=1) column of 'measMatr' with main measures of comparison |
limitToBest |
(integer) column of 'measMatr' with main measures of comparison |
asDataFrame |
(logical) convert results to data.frame if non-numeric matrix produced (may slightly slow down big results) |
origNa |
(logical) will try to use original names of objects 'predMatr','measMatr', if they are not multi-column and not conflicting other output-names (otherwise 'predMatr','measMatr' will appear) |
silent |
(logical) suppress messages |
callFrom |
(character) allows easier tracking of messages produced |
debug |
(logical) for bug-tracking: more/enhanced messages |
Details
Additional information (covariables, annotation, ...) may be included as optional columns for either 'predMatr' or 'measMatr'.
Note : It is important to run findCloseMatch with sortMatch=FALSE !
Note : Results presented based on view of 'predMatr', so if multiple 'measMatr' are at within tolared distance, lines of 'measMatr' will be repeated;
Note : Distances 'disToMeas' and 'ppmToPred' are oriented : neg value if measured is lower than predicted (and pos values if higher than predicted);
Note : Returns NULL when nothing within given limits of comparison;
Value
This function returns results as matrix-view based on initial results from findCloseMatch, including optional columns of suppelemental data for both sets of data for comparison. Returns NULL when nothing within limits
See Also
findCloseMatch, checkSimValueInSer
Examples
aA <- c(11:17); bB <- c(12.001,13.999); cC <- c(16.2,8,9,12.5,15.9,13.5,15.7,14.1,5)
(cloMa <- findCloseMatch(aA,cC,com="diff",lim=0.5,sor=FALSE))
# all matches (of 2d arg) to/within limit for each of 1st arg ('x'); 'y' ..to 2nd arg = cC
(maAa <- closeMatchMatrix(cloMa,aA,cC,lim=TRUE)) #
(maAa <- closeMatchMatrix(cloMa,aA,cC,lim=FALSE,origN=TRUE)) #
(maAa <- closeMatchMatrix(cloMa,cbind(valA=81:87,aA),cbind(valC=91:99,cC),colM=2,
colP=2,lim=FALSE))
(maAa <- closeMatchMatrix(cloMa,cbind(aA,valA=81:87),cC,lim=FALSE,deb=TRUE)) #
a2 <- aA; names(a2) <- letters[1:length(a2)]; c2 <- cC; names(c2) <- letters[10+1:length(c2)]
(cloM2 <- findCloseMatch(x=a2,y=c2,com="diff",lim=0.5,sor=FALSE))
(maA2 <- closeMatchMatrix(cloM2,predM=cbind(valA=81:87,a2),measM=cbind(valC=91:99,c2),
colM=2,colP=2,lim=FALSE,asData=TRUE))
(maA2 <- closeMatchMatrix(cloM2,cbind(id=names(a2),valA=81:87,a2),cbind(id=names(c2),
valC=91:99,c2),colM=3,colP=3,lim=FALSE,deb=FALSE))
Compare Means Of Two Vectors By Permutation Test
Description
Run coin-flipping like permutation tests (to compare difference of 2 means: 'x1' and 'x2') without any distribution-assumptions. This function uses the package coin, if not installed, the function will return NULL and give a warning.
Usage
coinPermTest(
x1,
x2,
orient = "two.sided",
nPerm = 5000,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x1 |
numeric vector (to be compared with vector 'x2') |
x2 |
numeric vector (to be compared with vector 'x1') |
orient |
(character) may be "two.sided","greater" or "less" |
nPerm |
(integer) number of permutations |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns an object of "MCp" class numeric output with p-values
See Also
oneway_test in LocationTests
Examples
coinPermTest(2, 3, nPerm=200)
rowCVs
Description
This function returns CV for values in each column (using speed optimized standard deviation). Note : NaN values get replaced by NA.
Usage
colCVs(dat, autoconvert = NULL, silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
dat |
(numeric) matix |
autoconvert |
(NULL or character) allows converting simple vectors in matrix of 1 row (autoconvert="row") |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Value
This function returns a (numeric) vector with CVs for each column of 'dat'
See Also
rowSums, rowCVs, rowGrpCV, colSds
Examples
set.seed(2016); dat1 <- matrix(c(runif(200) +rep(1:10,20)),ncol=10)
head(colCVs(dat1))
Standard Error Of Median For Each Column By Bootstrap
Description
Determine standard error (sd) of median by bootstraping for multiple sets of data (rows in input matrix 'dat'). Note: The package boot must be installed from CRAN.
Usage
colMedSds(dat, nBoot = 99, silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
dat |
(numeric) matix |
nBoot |
(integer, length=1) number if iterations |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a (numeric) vector with estimated standard errors
See Also
Examples
set.seed(2016); dat1 <- matrix(c(runif(200) +rep(1:10,20)), ncol=10)
colMedSds(dat1)
sd for each column
Description
This function is speed optimized sd per column of a matrix or data.frame and treats each column as independent set of data for sd (equiv to apply(dat,2,sd)).
NAs are ignored from data. Speed improvements may be seen at more than 100 columns
Usage
colSds(dat, silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
dat |
matrix (or data.frame) with numeric values (may contain NAs which will be ignored) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Value
numeric vector of sd values
See Also
Examples
set.seed(2016); dat1 <- matrix(c(runif(200) +rep(1:10,20)), ncol=10)
colSds(dat1)
Transform Numeric Values To Color-Gradient
Description
This function helps making color-gradients for plotting a numerical variable. Note : RColorBrewer palettes were not integrated here/yet.
Usage
colorAccording2(
x,
gradTy = "rainbow",
nStartOmit = NULL,
nEndOmit = NULL,
revCol = FALSE,
alpha = 1,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
(character) color input |
gradTy |
(character) type of gradeint may be 'rainbow', 'heat.colors', 'terrain.colors', 'topo.colors', 'cm.colors', 'hcl.colors', 'grey.colors', 'gray.colorsW' or 'logGray' |
nStartOmit |
(integer) omit n steps from begining of gradient range |
nEndOmit |
(integer or "sep") omit n steps from end of gradient range, if |
revCol |
(logical) reverse order |
alpha |
(numeric) optional transparency value (1 for no transparency, 0 for complete opaqueness) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a character vector (of same length as x) with color encoding
See Also
Examples
set.seed(2015); dat1 <- round(runif(15),2)
plot(1:15,dat1,pch=16,cex=2,col=colorAccording2(dat1))
plot(1:15,dat1,pch=16,cex=2,col=colorAccording2(dat1,nStartO=0,nEndO=4,revCol=TRUE))
plot(1:9,pch=3)
points(1:9,1:9,col=transpGraySca(st=0,en=0.8,nSt=9,trans=0.3),cex=42,pch=16)
Planing For Making All Multiplicative Combinations
Description
This function provides all combinations for each of n elements of vector 'nMax' (positive integer, eg number of max multiplicative value). For example, imagine, we have 3 cities and the (maximum) voting participants per city. Results must be read vertically and allow to see all total possible compositons.
Usage
combinatIntTable(
nMax,
include0 = TRUE,
asList = FALSE,
callFrom = NULL,
debug = FALSE,
silent = TRUE
)
Arguments
nMax |
(positive integer) could be max number of voting participants form different cities, eg Paris max 2 persons, Lyon max 1 person ... |
include0 |
(logical) include 0 occurances, ie provide al combinations starting from 0 or from 1 up to nMax |
asList |
(logical) return result as list or as array |
callFrom |
(character) allow easier tracking of messages produced d |
debug |
(logical) additional messages for debugging |
silent |
(logical) suppress messages |
Value
This function retruns a list or array (as 2- or 3 dim) with possible number of occurances for each of the 3 elements in nMax. Read results vertical : out[[1]] or out[,,1] .. (multiplicative) table for 1st element of nMax; out[,,2] .. for 2nd
See Also
Examples
combinatIntTable(c(1,1,1,2), include0=TRUE, asList=FALSE, silent=TRUE)
## Imagine we have 3 cities and the (maximum) voting participants per city :
nMa <- c(Paris=2, Lyon=1, Strasbourg=1)
combinatIntTable(nMa, include0=TRUE, asList=TRUE, silent=TRUE)
Combine Vectors From List And Return Basic Count Statistics
Description
The aim of this function is to choose a fixed number (nCombin) of list-elments from lst and count the number of common values/words.
Furthermore, one can define levels to fine-tune the types of combinations to examine.
In case multiple combinations for a given level are possible, some basic summary statistics are provided, too.
Usage
combineAsN(
lst,
lev = NULL,
nCombin = 3,
remDouble = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
lst |
(list of character or integer vectors) main input |
lev |
(character) define groups of |
nCombin |
(integer) number of list-elements to combine from |
remDouble |
(logical) remove intra-duplicates (defaults to |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
Note of caution :
With very long lists and/or high numbers of repeats of given levels, however, the computational effort incerases very much (like it does when using table).
Thus, when exploring all different combinations of large data-sets may easily result in queries consuming many ressources (RAM and processing time) !
It is recommended to start testing with test smaller sub-groups.
The main idea of this function is to count frequency of terms when combining different drawings.
For example, you ask students from different cities which are their preferred hobbies, they may have different preference depending on the city ( defined by lev).
Now, if you want to make groups of 3 students, possibly with one from each city (A ,B and C), you want to count (/estimate) the frequency of different combinations possible.
Thus, using this function all combinations of the students from city A with the students from city B and C will be made when counting the number of common hobbies (by nCombin students).
Then, all counting results will be summarized to the average count for the various categories (which hobbies were seen once, twice or 3 times...),
sem (standard error of the mean) and CI (95
Of course, the number of potential combinations may quickly get very large. Using the argument remDouble=TRUE you can limit the search to
either finding all students giving the same answer plus all student giving different answers.
In this case, when a given level appears multiple times, all possible combinations using one of the respective entries will be be made with the other levels.
Value
This function returns an array with 3 dimensions : i) ii) the combinations of nCombin list-elements,
iii) the number of counts (n), sem (standard error of the mean), CI (confidence interval) and sd
See Also
Examples
## all list-elements are considered equal
tm1 <- list(a1=LETTERS[1:17], a2=LETTERS[3:19], a3=LETTERS[6:20], a4=LETTERS[8:22])
combineAsN(tm1, lev=gl(1,4))[,1,]
## different levels/groups in list-elements
tm4 <- list(a1=LETTERS[1:15], a2=LETTERS[3:16], a3=LETTERS[6:17], a4=LETTERS[8:19],
b1=LETTERS[5:19], b2=LETTERS[7:20], b3=LETTERS[11:24], b4=LETTERS[13:25], c1=LETTERS[17:26],
d1=LETTERS[4:12], d2=LETTERS[5:11], d3=LETTERS[6:12], e1=LETTERS[7:10])
te4 <- combineAsN(tm4, nCombin=4, lev=substr(names(tm4),1,1))
str(te4)
te4[,,1]
Create factor-like column regrouping data regrouping simultaneaously by two factors
Description
This function aims to address the situation when two somehow different groupins (of the same data) exist and need to be joined.
It is not necessary that both alternative groupings use the same labels, neither.
combineByEitherFactor adds new (last) column named 'grp' to input matrix representing the combined factor
relative to 2 specified columns from input matrix mat (via 'refC1','refC2'). Optionally, the output may be
sorted and a column giving n per factor-level may be added.
The function treats selected columns of mat
as pairwise combination of 2 elements (that may occur multiple times over all lines of mat)
and sorts/organizes all instances of such combined elements (ie from both selected columns) as repeats of a given group,
who's class number is given in output column 'grp', the (total) number of repeats may be displayed in column 'nGrp' ( nByGrp=TRUE).
If groups are overlapping (after re-ordering), an iterative process of max 3x2 passes will be launched after initial matching.
Works on numeric as well as character input.
Usage
combineByEitherFactor(
mat,
refC1,
refC2,
nByGrp = FALSE,
convergeMax = TRUE,
callFrom = NULL,
debug = FALSE,
silent = FALSE
)
Arguments
mat |
main input matrix |
refC1 |
(integer) column-number of 'mat' to use as 1st set |
refC2 |
(integer) column-number of 'mat' to use as 2nd set |
nByGrp |
(logical) add last col with n by group |
convergeMax |
(logical) if |
callFrom |
(character) allow easier tracking of message(s) produced |
debug |
(logical) display additional messages for debugging |
silent |
(logical) suppress messages |
Value
This function returns a matrix containing both selected columns plus additional column(s) indicating group-number of the pair-wise combination (and optional the total n by group)
Examples
nn <- rep(c("a","e","b","c","d","g","f"),c(3,1,2,2,1,2,1))
qq <- rep(c("m","n","p","o","q"),c(2,1,1,4,4))
nq <- cbind(nn,qq)[c(4,2,9,11,6,10,7,3,5,1,12,8),]
combineByEitherFactor(nq,1,2,nBy=TRUE); combineByEitherFactor(nq,1,2,nBy=FALSE)
combineByEitherFactor(nq,1,2,conv=FALSE); combineByEitherFactor(nq,1,2,conv=TRUE)
##
mm <- rep(c("a","b","c","d","e"),c(3,4,2,3,1)); pp <- rep(c("m","n","o","p","q"),c(2,2,2,2,5))
combineByEitherFactor(cbind(mm,pp), 1, 2, con=FALSE, nBy=TRUE)
combineByEitherFactor(cbind(mm,pp), 1, 2, con=TRUE, nBy=TRUE)
Find And Combine Points Located Very Close In x/y Space
Description
Search points in x,y space that are located very close and thus likely to overlap. In case of points close enough, various options for joining names (and shortening longer descriptions) are available.
Usage
combineOverlapInfo(
dat,
suplInfo = NULL,
disThr = 0.01,
addNsimil = TRUE,
txtSepChar = ",",
combSym = "+",
maxOverl = 50,
callFrom = NULL,
debug = FALSE,
silent = FALSE
)
Arguments
dat |
(matrix) matrix or data.frame with 2 cols (used ONLY 1st & 2nd column !), used as x & y coordinates |
suplInfo |
(NULL or character) when points are considered overlapping the text from 'suplInfo' will be reduced to fragment before 'txtSepChar' and combined (with others from overlapping text) using 'combSym', if NULL $combInf will appear with row-numbers |
disThr |
(numeric) distance-thrshold for considering as similar via searchDataPairs() |
addNsimil |
(logical) include number of fused points |
txtSepChar |
(character) for use with .retain1stPart(): where to cut (& keep 1st part) text from 'suplInfo' to return in out$CombInf; only 1st element used ! |
combSym |
(character) concatenation symbol (character, length=1) for points considered overlaying, see also 'suplInfo' |
maxOverl |
(integer) if NULL no limit or max limit of group/clu size (avoid condensing too many neighbour points to single cloud) |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) additional messages for debugging |
silent |
(logical) suppres messages |
Value
This function returns a matrix with fused (condensed) information for cluster of overapping points
Examples
set.seed(2013)
datT2 <- matrix(round(rnorm(200)+3,1),ncol=2,dimnames=list(paste("li",1:100,sep=""),
letters[23:24]))
# (mimick) some short and longer names for each line
inf2 <- cbind(sh=paste(rep(letters[1:4],each=26),rep(letters,4),1:(26*4),sep=""),
lo=paste(rep(LETTERS[1:4],each=26),rep(LETTERS,4),1:(26*4),",",rep(letters[sample.int(26)],4),
rep(letters[sample.int(26)],4),sep=""))[1:100,]
head(datT2,n=10)
head(combineOverlapInfo(datT2,disThr=0.03),n=10)
head(combineOverlapInfo(datT2,suplI=inf2[,2],disThr=0.03),n=10)
Combine/reduce redundant lines based on specified column
Description
This function works similar to unique, but it takes a matrix as input and considers one specified column to find unique instances.
It identifies 'repeated' lines of the input-matrix (or data.frame) 'mat' based on (repeated) elements in/of column with name 'colNa' (or column-number).
Redundant lines (ie repeated lines) will disappear in output.
Eg used with extracted annotation where 1 gene has many lines for different GO annotation.
Usage
combineRedBasedOnCol(mat, colNa, sep = ",", silent = FALSE, callFrom = NULL)
Arguments
mat |
input matrix or data.frame |
colNa |
character vector (length 1) macting 1 column name (if mult only 1st will be used), in case of mult matches only 1st used |
sep |
(character) separator (default=",") |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
Value
matrix containing the input matrix without lines considered repeated (unique-like)
See Also
findRepeated, firstOfRepLines, organizeAsListOfRepl, combineRedundLinesInList
Examples
matr <- matrix(c(letters[1:6],"h","h","f","e",LETTERS[1:5]),ncol=3,
dimnames=list(letters[11:15],c("xA","xB","xC")))
combineRedBasedOnCol(matr,colN="xB")
combineRedBasedOnCol(rbind(matr[1,],matr),colN="xB")
Combine Redundant Lines In List
Description
This function provides help for combining/summarizing lines of numeric data which may be summaried according to reference vector or matrix of annotation (part of the same input-list). The data and reference will be aligned and data corresponding to redundant information be combined/summarized.
Usage
combineRedundLinesInList(
lst,
refNa = "ref",
datNa = "quant",
refColNa = "GeneName",
supRefColNa = NULL,
summarizeType = "av",
NA.rm = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
lst |
(list) main input, containing matrix or data.frame of numeric data (see |
refNa |
(character) name of list-element containing annotation |
datNa |
(character) name(s) of list-element(s) containing numeric/quantitation data |
refColNa |
(character) in case the list-element to be used as reference is |
supRefColNa |
(character) in case the |
summarizeType |
(character) the summarization method gets specified here; so far 'sum','av','med','first' and 'last' are implemented |
NA.rm |
(logical) pass to summarizing functions order to omit |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
All input data should be in a list, ie one or multipl matrix or data.frame for numeric data (see argument datNa), as well as the reference (see argument refNa).
The refgerence may be a named character vecor or a matrix for which the column to be used should be specified using the argument refColNa.
In case the annotation is a matrix, the rownames will be used as unique/independent identifyers to adjust potentially different order of numeric data and annotation.
In absence of rownames, an additional column supRefColNa of the annotation may be designed for adjusting the order of annotation and numeric data.
The numeric list may contain multiple matrixes or data.frames which will all be summarized by the same procedure as long as they have the same initial dimensions and are specified by refNa.
Please note that all other list elements from input not specified by refNa (or datNa) will be maintained in the output just as they are.
Value
This function returns a list of same length as input
See Also
findRepeated, firstOfRepLines, organizeAsListOfRepl, combineRedBasedOnCol
Examples
x1 <- list(quant=matrix(11:34, ncol=3, dimnames=list(letters[8:1], LETTERS[11:13])),
annot=matrix(paste0(LETTERS[c(1:4,6,3:5)],LETTERS[c(1:4,6,3:5)]), ncol=1,
dimnames=list(paste(letters[1:8]),"xx")) )
combineRedundLinesInList(lst=x1, refNa="annot", datNa="quant", refColNa="xx")
Combine Redundant Lines In List, Deprecated
Description
The function combineRedundLinesInListAcRef() has been deprecated and replaced by combineRedundLinesInList() from the same package
Usage
combineRedundLinesInListAcRef(
lst,
listNa = c("ref", "quant"),
refColNa = "xx",
summarizeType = "av",
NA.rm = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
lst |
(list) main input |
listNa |
(character) names of list-elements containing quantitation data (1st position) and protein/line annotation (2nd position) |
refColNa |
(character) in case the list-element to be used as reference is |
summarizeType |
(character) the summarization method gets specified here; so far 'sum','av','med','first' and 'last' are implemented |
NA.rm |
(logical) pass to summarizing functions order to omit |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a list of same length as input
See Also
Examples
x1 <- list(quant=matrix(11:34, ncol=3, dimnames=list(letters[8:1], LETTERS[11:13])),
annot=matrix(paste0(LETTERS[c(1:4,6,3:5)],LETTERS[c(1:4,6,3:5)]), ncol=1,
dimnames=list(paste(letters[1:8]),"xx")) )
## please use combineRedundLinesInList()
combineRedundLinesInList(lst=x1, refNa="annot", datNa="quant", refColNa="xx")
Combine replicates from list to matrix
Description
Suppose multiple measures (like multiple chanels) are taken for subjects and these measures are organized as groups in a list, like muliple parameters (= channels) or types of measurements (typically many paramters are recorded when screeinig compounds in microtiter plates). Within one parameter/channel all replicate-data from separate list-entries ('lst') will get combined according to names of list-elements. The function will trim any redundant text in names of list-elements, try to isolate separator (may vary among replicate-groups, but should be 1 character long). eg names "hct116 1.1.xlsx" & "hct116 1.2.xlsx" will be combined as replicates, "hct116 2.1.xlsx" will be considered as new group.
Usage
combineReplFromListToMatr(lst, silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
lst |
(list) list of arrays (typically multi-parameter measures of micortiterplate data) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a list of arrays now with same dimension of arrays (but shorter, since replicate-arrays were combined)
See Also
extr1chan, organizeAsListOfRepl
Examples
lst2 <- list(aa_1x=matrix(1:12,nrow=4,byrow=TRUE),ab_2x=matrix(24:13,nrow=4,byrow=TRUE))
combineReplFromListToMatr(lst2)
Get All Combinations With TRUE From Each Column
Description
This function addresses the case when multiple alternatove ways exit to combine two elements.
combineSingleT makes combinatory choices : if multiple TRUE in given column of 'mat' make all multiple selections with always one TRUE from each column
The resultant output contains index for first and second input columns elements to be combined.
Usage
combineSingleT(mat, silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
mat |
2-column matrix of logical values |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Value
This function returns a matrix with indexes of conbinations of TRUE
Examples
## Example: Fist column indicates which boys want to dance and second column
## which girls want to dance. So if several boys want to dance each of the girls
## will have the chance to dance with each of them.
matr <- matrix(c(TRUE,FALSE,TRUE,FALSE,TRUE,FALSE),ncol=2)
combineSingleT(matr)
Complete List Of Arrays For Same Dimensions
Description
This functions aims to inspect repeating structues of data given as list of arrays and will try to complete arrays with fewer lines or columns (as this may appear eg with the very last set of high-thourput sceening data if fewer measures remain in the last set). Thus, the dimensions of the arrays are compared and cases with fewer (lost) columns (eg fewer experimental replicates) will be adjust/complete by adding column(s) of NA. Used eg when at reading mircotiterplate data the last set is not complete.
Usage
completeArrLst(arrLst, silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
arrLst |
(list) list of arrays (typically 1st and 2nd dim for specific genes/objects, 3rd for different measures associated with) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of message(s) produced |
Value
This function returns a list of arrays, now with same dimension of arrays
See Also
organizeAsListOfRepl, extr1chan
Examples
arr1 <- array(1:24,dim=c(4,3,2),dimnames=list(c(LETTERS[1:4]),
paste("col",1:3,sep=""),c("ch1","ch2")))
arr3 <- array(81:96,dim=c(4,2,2),dimnames=list(c(LETTERS[1:4]),
paste("col",1:2,sep=""),c("ch1","ch2")))
arrL3 <- list(pl1=arr1,pl3=arr3)
completeArrLst(arrL3)
Value Matching With Option For Concatenated Terms
Description
This is a _match()_-like function allowing to serach among concatenated terms/IDs, additional options to remove text pattern like terminal lowercase extesion are available.
The function returns a named vector indicating the positions of (first) matches similar to match.
Usage
concatMatch(
x,
table,
sep = ",",
sepPattern = NULL,
globalPat = "digitExtension",
nomatch = NA_integer_,
incomparables = NULL,
extensPat = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
(vector) the values to be matched |
table |
(vector) the values to be matched against (ie reference) |
sep |
(character) separator character in case concatenation of entries is tested |
sepPattern |
(character or |
globalPat |
(character) pattern for additional trimming of serach-terms. If |
nomatch |
(vector) similar to |
incomparables |
(vector) similar to |
extensPat |
(logical) similar to |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
The main motivation to create this function was to be able to treat concatenated entries and to look if any of the concatenated values match to 'x'.
This function offers additional options for trimming values before running the main comparison.
Of course, the concatenation strategy must be known and only a single concatenation separator (which may be multiple characters long) may be used for both x and match.
Thus result will only indicate that at least one of the concatenated terms had a match, but not which one.
Finally, both vectors x and table may contain concatenated terms.
In this case this function will require much more computational ressources due to the increased combinatorics when comparing larger vectors.
Please note, that in case of multiple to multiple matches, only the first hit gets reported.
The argument globalPat="digitExtension" allows eg reducing 'A1234-4' to 'A1234'.
Value
This function returns a character vector with verified path and file-name(s), returns NULL if nothing
See Also
match (for two simple vectors without concatenated terms), grep
Examples
tab1 <- c("AA","BB-5","CCab","FF")
tab2 <- c("AA","WW,Vde,BB-5,E","CCab","FF,Uef")
x1 <- c("ZZ","YY","AA","BB-2","DD","CCdef","Dxy") # modif of single ID (no concat)
concatMatch(x1, tab2)
x2 <- c("ZZ,Z","YY,Y","AA,Z,Y","BB-2","DD","X,CCdef","Dxy") # conatenated in 'x'
concatMatch(x2, tab2)
tab1 <- c("AA","BB-5","CCab","FF") # no conatenated in 'table'
concatMatch(x2, tab1) # simple case of no concat anywhere
concatMatch(x1, tab1)
Confidence Interval To Given Alpha
Description
This little function returns the confidence interval associated to a given significance level alpha under the hypothesis of the Normal distribution is valid.
Usage
confInt(x, alpha = 0.05, distrib = "Normal", silent = FALSE, callFrom = NULL)
Arguments
x |
(numeric) main input |
alpha |
(numeric) significance level, accepted type I error |
distrib |
(character) distribution, so far only |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of message(s) produced |
Value
This function returns the confidence interval to a given alpha under the hypothesis of the Normal distribution.
See Also
Examples
confInt(c(5,2:6))
Characterize Individual Contribution Of Single Edges In Tree-Structures
Description
This function helps investigating tree-like structures with the aim of indicating how much individual tree components contribute to compose long stretches.
Usage
contribToContigPerFrag(
joinMat,
fullLength = NULL,
nDig = 3,
silent = FALSE,
callFrom = NULL,
debug = FALSE
)
Arguments
joinMat |
(matrix) matrix with concatenated edges as rownames (separated by slashes), column |
fullLength |
(integer) custom total length (useful if the concatenated edges do not cover 100 percent of the original precursor whose fragments are studied) |
nDig |
(integer) rounding: number of digits for 3rd column |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) additional messages for debugging |
Details
contribToContigPerFrag characterizes individual (isolated) contribution of single edges in tree-structures.
Typically used to process/exploit summarized trees (as matrix) made by buildTree which makes use of the package data.tree.
For example if A,B and C can be joined aa well and B +D, this function will check if A+B+C is longer and if A contributes to the longest tree.
Value
This function returns a matrix of 3 columns for each node identified in rownames of joinMatr for length of longest tree-branches where given edge participates (column sumLen), the (total) number of edges therein (col n.frag) and a relative value (len.rat)
See Also
to build tree buildTree
Examples
path1 <- matrix(c(17,19,18,17, 4,4,2,3), ncol=2,
dimnames=list(c("A/B/C/D","A/B/G/D","A/H","A/H/I"),c("sumLen","n")))
contribToContigPerFrag(path1)
Convert matrix of integer to matrix of x-times repeated column-names
Description
conv01toColNa transforms matrix of integers (eg 0 and 1) to repeated & concatenated text from argument colNa,
the character string for 0 occurances of argument zeroTex may be customized.
Used eg when specifying (and concatenating) various counted elements (eg properties) along a vector like variable peptide modifications in proteomics.
Usage
conv01toColNa(mat, colNa = NULL, zeroTex = "", pasteCol = FALSE)
Arguments
mat |
input matrix (with integer values) |
colNa |
alternative (column-)names to the ones from 'mat' (default colnames of 'mat') |
zeroTex |
text to display if 0 (default "") |
pasteCol |
(logical) allows to collapse all columns to single chain of characters in output |
Value
character vector
Examples
(ma1 <- matrix(sample(0:3,40,repl=TRUE), ncol=4, dimnames=list(NULL, letters[11:14])))
conv01toColNa(ma1)
conv01toColNa(ma1, colNa=LETTERS[1:4], ze=".")
conv01toColNa(ma1, colNa=LETTERS[1:4], pasteCol=TRUE)
Assign new transparency to given colors
Description
This function alows (re-)defining a new transparency. A color encoding vector will be transformed to the same color(s) but with new transparency (alpha).
Usage
convColorToTransp(color, alph = 1)
Arguments
color |
(character) color input |
alph |
(numeric) transparency value (1 for no transparency, 0 for complete opaqueness), values <1 will be treated as percent-values |
Value
character vector (of same length as input) with color encoding for new transparency
See Also
Examples
col0 <- c("#998FCC","#5AC3BA","#CBD34E","#FF7D73")
col1 <- convColorToTransp(col0,alph=0.7)
layout(1:2)
pie(rep(1,length(col0)),col=col0)
pie(rep(1,length(col1)),col=col1,main="new transparency")
Convert matrix (eg with redundant) row-names to data.frame
Description
This function provides flexible converting of matrix to data.frame.
For example repeated/redundant rownames are not allowed in data.frame(), thus the corresponding column-names have to be renamed using a counter-suffix.
In case of non-redundant rownames, a new column 'addIniNa' will be introduced at beginning to document the initial (redundant) rownames,
non-redundant rownames will be created.
Finally, this functions converts the corrected matrix to data.frame and checks/converts columns for transforming character to numeric if possible.
If the input is a data.frame containing factors, they will be converted to character before potential conversion.
Note: for simpler version (only text to numeric) see from this package .convertMatrToNum .
Usage
convMatr2df(
mat,
addIniNa = TRUE,
duplTxtSep = "_",
silent = FALSE,
callFrom = NULL
)
Arguments
mat |
matrix (or data.frame) to be converted |
addIniNa |
(logical) if |
duplTxtSep |
(character) separator for enumerating replicated names |
silent |
(logical) suppres messages |
callFrom |
(character) allow easier tracking of message(s) produced |
Value
This functions returns a data.frame equivalent to the input matrix, an additional column named 'ID' will be added for initial rownames
See Also
numeric, for simpler version (only text to numeric) see from this package .convertMatrToNum
Examples
dat1 <- matrix(1:10, ncol=2)
rownames(dat1) <- letters[c(1:3,2,5)]
## as.data.frame(dat1) ... would result in an error
convMatr2df(dat1)
df1 <- data.frame(a=as.character((1:3)/2), b=LETTERS[1:3], c=1:3)
str(convMatr2df(df1))
df2 <- df1; df2$b <- as.factor(df2$b)
str(convMatr2df(df2))
Check Comparison-Choice
Description
This function aims to help getting organized with pairwise (statistical) testing since there are multiple ways of expressing how samples should be grouped for tests. For example this may be either as combined character strings (eg 'A-B') or as separate elements. This function takes most input-formats and returns multiple converted formats.
Usage
convPairwiseSetup(
useComparison,
grp,
experSetup = NULL,
sep = NULL,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
useComparison |
(numeric or character vector or matrix) the argument allowing to specify the pairwise comparions
may be character as result of combining two group-names (from argument |
grp |
(character or factor) vector defining groups of replicates for additional checking (may also be just the levels of grp) |
experSetup |
(list) optional esperimental setup (list with $ind, $pwGrpIndex,$sep and $pwGrpNa as obtained using |
sep |
(character) optional custom separator to use for splitting |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Details
This function returns a list with $pwGrpNa (matrix with separated elements), $pwIndex (matrix with separated indexes), $grpNa (levels of grp, ie sorted),
$sep (character vecor of separator found/used or suggested), $concat (pairwise concatenated names, eg 'A-B')
Value
This function returns a list with $data, $nNA, $randParam, $NAneigLst, $seed, $filt, and $annot
See Also
presenceFilt, getPWseparator, indexGroupsFromPW, getPairwiseSetup, strsplit;
getPWseparator for default optimal separator; this function is used in moderTestXgrp
Examples
convPairwiseSetup(c("B-C","D-A"), LETTERS[1:4])
convPairwiseSetup(c("B","C"), LETTERS[1:3])
convPairwiseSetup("all", LETTERS[1:3])
convPairwiseSetup(2:3, LETTERS[1:3])
convPairwiseSetup(2:3, LETTERS[1:3], sep="__")
convPairwiseSetup(matrix(c("B","D","C","A"), ncol=2), LETTERS[1:4])
Convert Vector To Numeric
Description
This function checks if input vector/character string contains numbers (with or without comma) and attempts converting to numeric.
This functions was designed for extracting the numeric part of character-vectors (or matrix) containing both numbers and character-elements.
Depending on the parameters convert and remove text-entries can be converted to NA (in resulting numeric objects) or removed (the number of elements/lines gets reduced, in consequece).
Note: if 'x' is a matrix, its matrix-dimensions & -names will be preserved.
Note: so far Inf and -Inf do not get recognized as numeric.
Usage
convToNum(
x,
autoConv = TRUE,
spaceRemove = TRUE,
convert = c(NA, "sparseChar"),
remove = NULL,
euroStyle = TRUE,
sciIncl = TRUE,
callFrom = NULL,
silent = TRUE,
debug = FALSE
)
Arguments
x |
vector to be converted |
autoConv |
(logical) simple automatic conversion based on function |
spaceRemove |
(logical) to remove all heading and trailing (white) space (until first non-space character) |
convert |
(character) define which type of non-conform entries to convert to NAs. Note, if |
remove |
(character) define which type of non-conform entries to remove, removed items cannot be converted to |
euroStyle |
(logical) if |
sciIncl |
(logical) include recognizing scientific notation (eg 2e-4) |
callFrom |
(character) allow easier tracking of messages produced |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
Details
This function may be used in two modes, depening if argument autoConv is TRUE or FALSE.
The first options allows accessing an automatic mode based on as.numeric,
while the second options investigates all characters if they may belong to numeric expressions and allows removing specific text-elements.
Value
This function returns a numeric vector (or matrix (if 'x' is matrix))
See Also
numeric and as.numeric (on same help-page)
Examples
x1 <- c("+4"," + 5","6","bb","Na","-7")
convToNum(x1)
convToNum(x1, autoConv=FALSE, convert=c("allChar"))
convToNum(x1, autoConv=FALSE) # too many non-numeric instances for 'sparseChar'
x2 <- c("+4"," + 5","6","-7"," - 8","1e6","+ 2.3e4","-3E4","- 4E5")
convToNum(x2)
convToNum(x2, autoConv=FALSE, convert=NA,remove=c("allChar",NA))
convToNum(x2, autoConv=FALSE, convert=NA,remove=c("allChar",NA),sciIncl=FALSE)
get coordinates of values/points in matrix according to filtering condition
Description
Get coordinates of values/points in matrix according to filtering condition
Usage
coordOfFilt(mat, cond, sortByRows = FALSE, silent = FALSE, callFrom = NULL)
Arguments
mat |
(matrix or data.frame) matrix or data.frame |
cond |
(logical or integer) condition/test to see which values of |
sortByRows |
(logical) optional sorting of results by row-index |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of message(s) produced |
Value
matrix columns 'row' and 'col'
See Also
Examples
set.seed(2021); ma1 <- matrix(sample.int(n=40,size=27,replace=TRUE), ncol=9)
## let's test which values are >37
which(ma1 >37) # doesn't tell which row & col
coordOfFilt(ma1, ma1 >37)
Correct vector to unique
Description
correctToUnique checks 'x' for unique entries, while maintaining the original length. If necessary a counter will added to non-unique entries.
Usage
correctToUnique(
x,
sep = "_",
atEnd = TRUE,
maxIter = 4,
NAenum = TRUE,
silent = FALSE,
callFrom = NULL
)
Arguments
x |
input character vector |
sep |
(character) separator used when counter |
atEnd |
(logical) decide location of placing the counter (at end or at beginning of initial text) |
maxIter |
(numeric) max number of iterations |
NAenum |
(logical) if |
silent |
(logical) suppress messages |
callFrom |
(character) for better tracking of use of functions |
Value
This function returns a character vector
See Also
unique will simply remove repeated elements, ie length of 'x' won't remain constant, filtSizeUniq is more complex and slower, treatTxtDuplicates
Examples
correctToUnique(c("li0","n",NA,NA,rep(c("li2","li3"),2),rep("n",4)))
Correct Mixed Slash And Backslash In File-Path
Description
This function corrects paths character strings for mixed slash and backslash in file path.
In Windows the function tempdir() will use double backslashes as separator while file.path() uses regular slashes.
So when combining these two one might encounter a mix of slashes and double backslashes which may cause trouble, unless this is streightened out to a single separator used.
When pointig to given files inside html-files, paths need to have a prefix, this can be added using the argument asHtml.
Usage
correctWinPath(
x,
asHtml = FALSE,
anyPlatf = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
(character) input path to test and correct |
asHtml |
(logical) option for use in html : add prefix "file:/" |
anyPlatf |
(logical, length=1) if |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Value
This function returns a character vector with corrected path
See Also
Examples
path1 <- 'D:\\temp\\Rtmp6X8/working_dir\\RtmpKC/example.txt'
(path1b <- correctWinPath(path1, anyPlatf=TRUE))
(path1h <- correctWinPath(path1, anyPlatf=TRUE, asHtml=TRUE))
Count From Two Vectors Number Of Values Close Within Given Limits
Description
This functions summarizes the serach of similar (or identical) numeric values from 2 initial vectors, it
evaluates the result from initial search run by findCloseMatch(), whose output is a less convenient list.
countCloseToLimits checks furthermore how many results within additional (more stringent)
distance-limits may be found and returns the number of distance values within the limits tested.
Designed for checking if threshold used with findCloseMatch() may be set more stringent, eg when searching reasonable FDR limits ...
Usage
countCloseToLimits(
closeMatch,
limitIdent = 5,
prefix = "lim_",
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
closeMatch |
(list) output from findCloseMatch(), ie list indicating which instances of 2 series of data have close matches |
limitIdent |
(numeric) max limit or panel of threshold values to test (if single value, in addtion a panel with values below will be tested) |
prefix |
(character) prefix for names of output |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns an integer vector with counts for number of list-elements with at least one absolue value below threshold, names
See Also
Examples
set.seed(2019); aa <- sample(12:15,20,repl=TRUE) +round(runif(20),2)-0.5
bb <- 11:18
match1 <- findCloseMatch(aa, bb, com="diff", lim=0.65)
head(match1)
(tmp3 <- countCloseToLimits(match1, lim=c(0.5,0.35,0.2)))
(tmp4 <- countCloseToLimits(match1, lim=0.7))
Count Same Start- And End- Sites Of Edges (Or Fragments)
Description
Suppose a parent sequence/string 'ABCDE' gets cut in various fragments (eg 'ABC','AB' ...).
countSameStartEnd counts how many (ie re-occuring) start- and end- sites of edges do occur in the input-data.
The input is presented as matrix of/indicating start- and end-sites of edges.
The function is used to characterize partially redundant edges and accumulation of cutting/breakage sites.
Usage
countSameStartEnd(
frag,
minFreq = 2,
nDig = 4,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
frag |
(matrix) 1st column |
minFreq |
(integer) min number of accumulated sites for taking into account (allows filtering with large datasets) |
nDig |
(integer) rounding: number of digits for columns |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced#' @return This function returns a matrix of 6 columns: input (beg and end), beg.n, beg.rat, end.n, end.rat |
See Also
to build initial tree buildTree, contribToContigPerFrag, simpleFragFig
Examples
frag1 <- cbind(beg=c(2,3,7,13,13,15,7,9,7, 3,3,5), end=c(6,12,8,18,20,20,19,12,12, 4,5,7))
rownames(frag1) <- letters[1:nrow(frag1)]
countSameStartEnd(frag1)
simpleFragFig(frag1)
Cut 3-dim array in list of matrixes (or arrays) similar to organizing into clusters
Description
cutArrayInCluLike cuts 'dat' (matrix,data.frame or 3-dim array) in list (of appended lines) according to 'cluOrg',
which serves as instruction which line of 'dat' should be placed in which list-element (like sorting according to cluster-numbers).
Usage
cutArrayInCluLike(dat, cluOrg, silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
dat |
array (3 dim) |
cluOrg |
(factor) organization of lines to clusters |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of message(s) produced |
Value
This function retruns a list of matrixes (or arrays)
Examples
mat1 <- matrix(1:30,nc=3,dimnames=list(letters[1:10],1:3))
cutArrayInCluLike(mat1,cluOrg=factor(c(2,rep(1:4,2),5)))
Cut Character-Vector At Multiple Sites
Description
This function cuts character vector after 'cutAt' (ie keep the search subtsting 'cutAt', different to strsplit).
Used for theoretical enzymatic digestion (eg in proteomics)
Usage
cutAtMultSites(y, cutAt, silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
y |
character vector (better if of length=1, otherwise one won't know which fragment stems from which input) |
cutAt |
(character) search subtsting, ie 'cutting rule' |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a modified (ie cut) character vector
See Also
strsplit, nFragments0, nFragments
Examples
tmp <- "MSVSRTMEDSCELDLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSKHGGNYLLFNLSERRPDITKLHAKVLEFGWPDLHTPALEKI"
cutAtMultSites(c(tmp,"ojioRij"),c("R","K"))
Cut numeric vector to n groups (ie convert to factor)
Description
This function is a more elaborate version of cut for cutting a the content of a
numeric vector 'x' into a given number of groups, taken from the length of 'lev'.
Besides, this function provides the group borders/limits for convention use with legends.
Usage
cutToNgrp(
x,
lev,
NAuse = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
numeric vector |
lev |
(character or numeric), the length of this argument tells the number of groups to be used for cutting |
NAuse |
(logical) include NAs as separate group |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Value
This function returns a list with $grouped telling which element of 'x' goes in which group and $legTxt with gourp-borders for convenient use with legends
See Also
Examples
set.seed(2019); dat <- runif(30) +(1:30)/2
cutToNgrp(dat,1:5)
plot(dat,col=(1:5)[as.numeric(cutToNgrp(dat,1:5)$grouped)])
Compute Matrix Of Differences For All Pairwise Combinations Of Numeric Vector
Description
diffCombin returns matrix of differences (eg resulting from subsititution) for all pairwise combinations of numeric vector 'x'.
Usage
diffCombin(
x,
diagAsNA = FALSE,
prefix = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
numeric vector to compute differences for all combinations |
diagAsNA |
(logical) return all self-self combinations as NA (otherwise 0) |
prefix |
(logical) if TRUE, dimnames of output will specify orientation (prefix='from.' and 'to.') |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Value
This function returns a numeric matrix of all pairwise differences
See Also
diff for simple differences
Examples
diffCombin(c(10,11.1,13.3,16.6))
Difference in ppm between numeric values
Description
This is a diff()-like function to return difference in ppm between subsequent values.
Result is oriented, ie neg ppm value means decrease (from higher to lower value). Note that if the absolute difference remains the same the difference in ppm will not remain same.
Any difference to NA is returned as NA, thus a single NA will result in two NAs in output (unless NA is 1st or last).
Usage
diffPPM(dat, toPrev = FALSE, silent = FALSE, callFrom = NULL)
Arguments
dat |
(numeric) vector for calculating difference to preceeding/following value in ppm |
toPrev |
(logical) determine oriention |
silent |
(logical) suppress messages |
callFrom |
(character) allows easier tracking of messages produced |
Value
This function returns a list with close matches of 'x' to given 'y', the numeric value dependes on 'sortMatch' (if FALSE then always value of 'y' otherwise of longest of x&y)
See Also
checkSimValueInSer and (from this package) .compareByDiff, diff
Examples
aa <- c(1000.01, 1000.02, 1000.05, 1000.08, 1000.09, 1000.08)
.compareByPPM(list(aa,aa), 30, TRUE) # tabular 'long' version
diffPPM(aa)
Eliminate Close (Overlapping) Points (in x & y space)
Description
This function reduces number of rows in 'dat' by eliminating lines where x & y coordinates (columns of matrix 'dat' defined by 'useCol') are identical (overlay points) or very close.
The stringency for 'close' values may be fine-tuned using nDig), this function uses internally firstOfRepeated.
Usage
elimCloseCoord(
dat,
useCol = 1:2,
elimIdentOnly = FALSE,
refine = 2,
nDig = 3,
callFrom = NULL,
silent = FALSE
)
Arguments
dat |
matrix (or data.frame) with main numeric input |
useCol |
(numeric) index for numeric columns of 'dat' to use/consider |
elimIdentOnly |
(logical) if TRUE, eliminate real duplicated points only (ie identical values only) |
refine |
(numeric) allows increasing stringency even further (higher 'refine' .. more lines considered equal) |
nDig |
(integer) number of significant digits used for rounding, if two 'similar' values are identical after this rounding the second will be eliminated. |
callFrom |
(character) allows easier tracking of messages produced |
silent |
(logical) suppress messages |
Value
This function returns the resultant matrix/data.frame
See Also
findCloseMatch, firstOfRepeated
Examples
da1 <- matrix(c(rep(0:4,5),0.01,1.1,2.04,3.07,4.5),nc=2); da1[,1] <- da1[,1]*99; head(da1)
elimCloseCoord(da1)
Equal character-length number
Description
equLenNumber convert numeric entry 'x' to text, with all elements getting the same number of characters (ie by adding preceeding or tailing 0s, if needed).
So far, this function cannot handle scientific annotations.
Usage
equLenNumber(x, silent = FALSE, callFrom = NULL, debug = FALSE)
Arguments
x |
(caracter) input vector |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) additional messages for debugging |
Value
This function returns a character vector formated as equal number of characters per value
See Also
Examples
equLenNumber(c(12,-3,321))
equLenNumber(c(12,-3.3,321))
Exclude Extreme Values (Based On Distance To Mean)
Description
This function aims to identify extreme values (values most distant to mean, thus potential outlyers), mark them as NA or directely exclude them (depending on 'showNAs').
Note that every set of non-identical values will have at least one most extreme value. Extreme values are part of many distributions, they are not necessarily true outliers.
Usage
exclExtrValues(
dat,
result = "val",
CVlim = NULL,
maxExcl = 1,
showNA = FALSE,
goodValues = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat |
numeric vector, main input |
result |
(character) may be 'val' for returning data without extreme values or 'pos' for returning position/index of extreme values |
CVlim |
(NULL or numeric) allows to retain extreme values only if a certain CV (for all 'dat') is exceeded (to avoid calling extreme values form homogenous data-sets) |
maxExcl |
(integer) max number of elments to explude |
showNA |
(logical) will display extrelme values as NA |
goodValues |
(logical) allows to display rather the good values instead of the extreme values |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a numeric vector without extreme values or index-position of extreme values
See Also
firstOfRepLines, get1stOfRepeatedByCol for treatment of matrix
Examples
x <- c(rnorm(30),-6,20)
exclExtrValues(x)
Normalize By Adjusting Exponent
Description
This function normalizes 'dat' by optimizing exponent function (ie dat ^exp) to fit best to 'ref' (default: average of each line of 'dat').
Usage
exponNormalize(
dat,
useExpon,
dynExp = TRUE,
nStep = 20,
startExp = 1,
simMeas = "cor",
refDat = NULL,
refGrp = NULL,
refLines = NULL,
rSquare = FALSE,
silent = FALSE,
callFrom = NULL,
debug = FALSE
)
Arguments
dat |
matrix or data.frame of numeric data to be normalized |
useExpon |
(numeric vector or matrix) exponent values to be tested |
dynExp |
(logical) require 'useExpon' as 2 values (matrix), will gradually increase exponent from 1st to 2nd; may be matrix or data.frame for dynamic, in this case 1st line for exp for lowest data, 2nd line for highest |
nStep |
(integer) number of exponent variations (steps) when testing range from-to |
startExp |
(numeric) |
simMeas |
(character) similarity metric to be used (so far only "cor"), if rSquare=TRRUE, the r-squared will be returned |
refDat |
(matrix or data.frame) if null average of each line from 'dat' will be used as reference in similarity measure |
refGrp |
(factor) designing which col of 'ref' should be used with which col of 'dat' (length equal to number of cols in 'dat'). Note: 'refGrp' not yet coded optimally to extract numeric part of character vector, protential problems when all lines or cols of dat are NA |
refLines |
(NULL or integer) optional subset of lines to be considered (only) when determining normalization factors |
rSquare |
(logical) if |
silent |
(logical) suppress messages |
callFrom |
(character) allows easier tracking of messages produced |
debug |
(logical) additional messages for debugging |
Value
This function returns a matrix of normalized data
See Also
more eveolved than normalizeThis with arugment set to 'exponent'
Examples
set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),nc=10)
head(rowGrpCV(dat1,gr=gl(4,3,labels=LETTERS[1:4])[2:11]))
set.seed(2016); dat1 <- c(0.1,0.2,0.3,0.5)*rep(c(1,10),each=4)
dat1 <- matrix(round(c(sqrt(dat1),dat1^1.5,3*dat1+runif(length(dat1))),2),nc=3)
dat2a <- exponNormalize(dat1[,1],useExpon=2,nSte=1,refD=dat1[,3])
layout(matrix(1:2,nc=2))
plot(dat1[,1],dat1[,3],type="b",main="init",ylab="ref")
plot(dat2a$datNor[,1],dat1[,3],type="b",main="norm",ylab="ref")
dat2b <- exponNormalize(dat1[,1],useExpon=c(1.7,2.3),nSte=5,refD=dat1[,3])
plot(dat1[,1],dat1[,3],type="b",main="init",ylab="ref")
plot(dat2b$datNor[,1],dat1[,3],type="b",main="norm",ylab="ref")
dat2c <- exponNormalize(dat1[,-3],useExpon=matrix(c(1.7,2.3,0.6,0.8),nc=2),nSte=5,refD=dat1[,3]);
plot(dat1[,1],dat1[,3],type="b",main="init",ylab="ref ")
plot(dat2c$datNor[,1],dat1[,3],type="b",main="norm 1",ylab="ref")
plot(dat1[,2],dat1[,3],type="b",main="init",ylab="ref")
plot(dat2c$datNor[,2],dat1[,3],type="b",main="norm 2",ylab="ref");
Extract Just One Series, ie One Channel, Of List Of Arrays
Description
This function was designed for handeling measurements stored as list of multiple arrays, like eg compound-screens using microtiter-plates where multiple parameters ('channels') were recorded for each well (element). The elements (eg compounds screened) are typcally stored in the 1st dimension of the arrays, the replicated in the secon dimension and different measure types/parameters in the 3rd chanel. In order to keep the structure of of individual microtiter-plates, typically each plate forms a separate array (of same dimensions) in a list. The this function allows extracting a single channel of the list of arrays (3rd dim of each array) and return row-appended matrix.
Usage
extr1chan(
arrLst,
cha,
na.rm = TRUE,
rowSep = "__",
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
arrLst |
(list) list of arrays (typically 1st and 2nd dim for specific genes/objects, 3rd for different measures associated with) |
cha |
(integer) channel number |
na.rm |
(logical) default =TRUE to remove NAs |
rowSep |
(character) separator for rows |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Value
This function returns a list with just single channel extracted
See Also
Examples
arr1 <- array(1:24,dim=c(4,3,2),dimnames=list(c(LETTERS[1:4]),
paste("col",1:3,sep=""),c("ch1","ch2")))
arr2 <- array(74:51,dim=c(4,3,2),dimnames=list(c(LETTERS[1:4]),
paste("col",1:3,sep=""),c("ch1","ch2")))
arrL1 <- list(pl1=arr1,pl2=arr2)
extr1chan(arrL1,ch=2)
Flexible extraction of columns
Description
This function provides flexible checking if a set of columns may be extracted from a matrix or data.frame 'x'.
If argument extrCol is list of character vectors, this allows to search among given options, the first matching name for each vector will be identified.
Usage
extrColsDeX(x, extrCol, doExtractCols = FALSE, callFrom = NULL, silent = FALSE)
Arguments
x |
(matrix or data.frame) main input (where data should be extracted from) |
extrCol |
(character, integer or list) columns to be extracted, may be column-names or column index; if is |
doExtractCols |
(logical) if default |
callFrom |
(character) allows easier tracking of message(s) produced |
silent |
(logical) suppress messages |
Value
integer-vector (ifdoExtractCols=FALSE return depending on input matrix or data.frame)
See Also
Examples
dFr <- data.frame(a=11:14, b=24:21, cc=LETTERS[1:4], dd=rep(c(TRUE,FALSE),2))
extrColsDeX(dFr,c("b","cc","notThere"))
extrColsDeX(dFr,c("b","cc","notThere"), doExtractCols=TRUE)
extrColsDeX(dFr, list(c("nn","b","a"), c("cc","a"),"notThere"))
Extract numeric part of matrix or data.frame
Description
This function extracts numeric part of matrix or data.frame, removing remaining non-numeric elements if trimToData is set to TRUE.
Note, that cropping entire lines where a (single) text element appeared may quickly reduce the overal content of the input data.
Usage
extrNumericFromMatr(
dat,
trimToData = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat |
matrix (or data.frame) for extracting numeric parts |
trimToData |
(logical) default to remove (crop) lines and cols contributing to NA, non-numeric data is transfomed to NA |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of message(s) produced |
Value
This function reurns a matrix of numeric data
Examples
mat <- matrix(c(letters[1:7],14:16,LETTERS[1:6]),nrow=4,dimnames=list(1:4,letters[1:4]))
mat; extrNumericFromMatr(mat)
mat <- matrix(c(letters[1:4],1,"e",12:19,LETTERS[1:6]),nr=5,dimnames=list(11:15,letters[1:4]))
mat; extrNumericFromMatr(mat)
Extract Specific Text
Description
This function extracts/cuts text-fragments out of txt following specific anchors defined by arguments cutFrom and cutTo.
Usage
extrSpcText(
txt,
cutFrom = " GN=",
cutTo = " PE=",
missingAs = NA,
exclFromTag = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
txt |
character vector to be treated |
cutFrom |
(character) text where to start cutting |
cutTo |
(character) text where to stop cutting |
missingAs |
(character) specific content of output at line/location of 'exclLi' |
exclFromTag |
(logical) to exclude text given in 'cutFrom' from result |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
In case cutFrom is not found missingAs will be returned.
In case cutTo is not found, text gets extracted with chaMaxEl characters.
Value
This function returns a modified character vector
See Also
Examples
extrSpcText(c(" ghjg GN=thisText PE=001"," GN=_ PE=", NA, "abcd"))
extrSpcText(c("ABCDEF.3-6","05g","bc.4-5"), cutFr="\\.", cutT="-")
Extract Last Two Numeric Parts From Character Vector
Description
This function extracts last 2 (integer) numeric parts between punctuations out of character vector 'x'.
Runs faster than gregexpr .
Note: won't work correctly with decimals or exponential signs !! (such characters will be considered as punctuation, ie as separator)
Usage
extractLast2numericParts(x, silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
x |
main character input |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a (numeric) matrix with 2 columns (eg from initial concatenated coordinates)
See Also
gregexpr from grep
Examples
extractLast2numericParts(c("M01.1-4","M001/2.5","M_0001_03-16","zyx","012","a1.b2.3-7,2"))
Filter three-dimensional array of numeric data
Description
Filtering of matrix or (3-dim) array x : filter column according to filtCrit (eg 'inf') and threshold filtVal
Usage
filt3dimArr(
x,
filtVal,
filtTy = ">",
filtCrit = NULL,
displCrit = NULL,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
array (3-dim) of numeric data |
filtVal |
(numeric, length=1) for testing inferior/superor/equal condition |
filtTy |
(character, length=1) which type of testing to perform (may be 'eq','inf','infeq','sup','supeq', '>', '<', '>=', '<=', '==') |
filtCrit |
(character, length=1) which column-name consider when filtering filter with 'filtVal' and 'filtTy' |
displCrit |
(character) column-name(s) to display |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
and extract/display all col matching 'displCrit'.
Value
This function returns a list of filtered matrixes (by 3rd dim)
See Also
filterList; filterLiColDeList;
Examples
arr1 <- array(11:34, dim=c(4,3,2), dimnames=list(c(LETTERS[1:4]),
paste("col",1:3,sep=""), c("ch1","ch2")))
filt3dimArr(arr1,displCrit=c("col1","col2"),filtCrit="col2",filtVal=7)
Filter For UniqueElements
Description
This function aims to identify and remove duplicated elements in a list and maintain the list-structure in the output.
filtSizeUniq filters 'lst' (list of character-vectors or character-vector) for elements being unique (to 'ref' or if NULL to all 'lst') and of character length.
In addition, the min- and max- character length may be filtered, too. Eg, in proteomics this helps removing peptide sequences which would not be measured/detected any way.
Usage
filtSizeUniq(
lst,
ref = NULL,
minSize = 6,
maxSize = 36,
filtUnique = TRUE,
byProt = TRUE,
inclEmpty = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
lst |
list of character-vectors or character-vector |
ref |
(character) optional alternative 'reference', if not |
minSize |
(integer) minimum number of characters, if |
maxSize |
(integer) maximum number of characters |
filtUnique |
(logical) if |
byProt |
(logical) if |
inclEmpty |
(logical) optional including empty list-elements when all elements have been filtered away - if 'lst' was named list |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
list of filtered input
See Also
correctToUnique, unique, duplicated
Examples
filtSizeUniq(list(A="a",B=c("b","bb","c"),D=c("dd","d","ddd","c")),filtUn=TRUE,minSi=NULL)
# input: c and dd are repeated
filtSizeUniq(list(A="a",B=c("b","bb","c"),D=c("dd","d","ddd","c")),ref=c(letters[c(1:26,1:3)],
"dd","dd","bb","ddd"),filtUn=TRUE,minSi=NULL) # a,b,c,dd repeated
Filter lines(rows) and/or columns from all suitable elements of list
Description
Filter all elements of list (or S3-object) according to criteria designed to one selected reference-element of the list. All simple vectors, matrix, data.frames and 3-dimensional arrays will be checked if matching number of rows and/or columns to decide if they should be filtered the same way. If the reference element has same number of rows and columns simple (1-dimensional) vectors won't be filtered since it not clear if this should be done to lines or columns.
Usage
filterLiColDeList(
lst,
useLines,
useCols = NULL,
ref = 1,
silent = FALSE,
callFrom = NULL,
debug = FALSE
)
Arguments
lst |
(list or S3 object) main input |
useLines |
(integer, logcial or character) vector to assign lines to keep when filtering along lines;
set to |
useCols |
(integer, logcial or character) vector for filtering columns; set to |
ref |
(integer) index for designing the elment of 'lst' to take as reference for checking which other list-elements have suitable number of rows or columns |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) additional messages for debugging |
Details
This function is used eg in package wrProteo to simultaneaously filter raw and transformed data.
Value
This function returns the correct(ed) input (object of same class, of same length)
See Also
moderTest2grp for single comparisons, lmFit
Examples
lst1 <- list(m1=matrix(11:18,ncol=2), m2=matrix(21:30,ncol=2), indR=31:34,
m3=matrix(c(21:23,NA,25:27,NA),ncol=2))
## here $m2 has more lines than $m1, and thus will be ignored when ref=1
filterLiColDeList(lst1, useLines=2:3)
filterLiColDeList(lst1, useLines="allNA", ref=4)
Filter for unique elements
Description
This function aims to apply a given filter-citerium, a matrix or vector of FALSE/TRUE which is typically combined with a second layer
which filters for a min content of filer-passing values per line for the first/main criterium.
Then all lines concerned will be removed. This will be done for all list-elements (of appropriate size) of the input-list
(while maintaining the list-structure in the output) not matching the filtering criteria.
Usage
filterList(lst, filt, minLineRatio = 0.5, silent = FALSE, callFrom = NULL)
Arguments
lst |
(list) main input, each vector, matrix or data.frame in this list will be filtered if its length or number of lines fits to |
filt |
(logical) vector of |
minLineRatio |
(numeric) in case |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of message(s) produced |
Value
filtered list
See Also
correctToUnique, unique, duplicated, extrColsDeX
Examples
set.seed(2020); dat1 <- round(runif(80),2)
list1 <- list(m1=matrix(dat1[1:40],ncol=8), m2=matrix(dat1[41:80],ncol=8), other=letters[1:8])
rownames(list1$m1) <- rownames(list1$m2) <- paste0("line",1:5)
filterList(list1, list1$m1[,1] >0.4)
filterList(list1, list1$m1 >0.4)
Filter nodes & edges for extracting networks
This function allows extracting and filtering network-data based on fixed threshold (limInt) and add sandwich-nodes (nodes inter-connecting initial nodes) out of node-based queries.
Description
Filter nodes & edges for extracting networks
This function allows extracting and filtering network-data based on fixed threshold (limInt) and add sandwich-nodes (nodes inter-connecting initial nodes) out of node-based queries.
Usage
filterNetw(
lst,
filtCol = 3,
limInt = 5000,
sandwLim = 5000,
filterAsInf = TRUE,
outFormat = "matrix",
remOrphans = TRUE,
remRevPairs = TRUE,
elemNa = "genes",
silent = FALSE,
callFrom = NULL,
debug = FALSE
)
Arguments
lst |
(list, composed of multiple matrix or data.frames ) main input (each list-element should have same number of columns) |
filtCol |
(integer, length=1) which column of |
limInt |
(numeric, length=1) filter main edge-scores according to |
sandwLim |
(numeric, length=1) filter sandwich connection edge-scores accodring to |
filterAsInf |
(logical) filter as 'inferior or equal' or 'superior or equal' |
outFormat |
(character) may be 'matrix' for tabular output, 'all' as list with matrix and list of node-names |
remOrphans |
(logical) remove networks consisting only of 2 connected edges |
remRevPairs |
(logical) remove duplicate edges due to reverse massping (eg A - B and B - A); NOTE : use only when edges don't have orientation ! |
elemNa |
(character) used only for messages |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of message(s) produced |
debug |
(logical) display additional messages for debugging |
Value
This function returns a matrix or data.frame
See Also
in cbind
Examples
lst2 <- list('121'=data.frame(ID=as.character(c(141,221,228,229,449)),11:15),
'131'=data.frame(ID=as.character(c(228,331,332,333,339)),11:15),
'141'=data.frame(ID=as.character(c(121,151,229,339,441,442,449)),c(11:17)),
'151'=data.frame(ID=as.character(c(449,141,551,552)),11:14),
'161'=data.frame(ID=as.character(171),11), '171'=data.frame(ID=as.character(161),11),
'181'=data.frame(ID=as.character(881:882),11:12) )
lst2 <- list('121'=data.frame(ID=as.character(c(141,221,228,229,449)),11:15, 21:25),
'131'=data.frame(ID=as.character(c(228,331,332,333,339)),11:15, 21:25),
'141'=data.frame(ID=as.character(c(121,151,229,339,441,442,449)), c(11:17), 21:27),
'151'=data.frame(ID=as.character(c(449,141,551,552)), 11:14, 21:24),
'161'=data.frame(ID=as.character(171), 11,21), '171'=data.frame(ID=as.character(161), 11,21),
'181'=data.frame(ID=as.character(881:882), 11:12,21:22) )
(te1 <- filterNetw(lst2, limInt=90, remOrphans=FALSE))
(te2 <- filterNetw(lst2, limInt=90, remOrphans=TRUE))
(te3 <- filterNetw(lst2, limInt=13, remOrphans=FALSE))
(te4 <- filterNetw(lst2, limInt=13, remOrphans=TRUE))
Find Close Numeric Values Between Two Vectors
Description
findCloseMatch finds close matches (similar values) between two numeric vectors ('x','y') based on method 'compTy' and threshold 'limit'.
Return list with close matches of 'x' to given 'y', the numeric value dependes on 'sortMatch' (if FALSE then always value of 'y' otherwise of longest of x&y).
Note: Speed & memory improvement if 'sortMatch'=TRUE (but result might be inversed!): adopt search of x->y or y->x to searching matches of each longest to each shorter (ie flip x &y).
Otherwise, if length of 'x' & 'y' are very different, it may be advantagous to use a long(er) 'x' and short(er) 'y' (with 'sortMatch'=FALSE).
Note: Names of 'x' & 'y' or (if no names) prefix letters 'x' & 'y' are always added as names to results.
Usage
findCloseMatch(
x,
y,
compTy = "ppm",
limit = 5,
asIndex = FALSE,
maxFitShort = 100,
sortMatch = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
numeric vector for comparison |
y |
numeric vector for comparison |
compTy |
(character) may be 'diff' or 'ppm', will be used with threshold from argument 'limit' |
limit |
(numeric) threshold value for retaining values, used with distace-type specified in argument 'compTy' |
asIndex |
(logical) optionally rather report index of retained values |
maxFitShort |
(numeric) limit output to max number of elements (avoid returning high number of results if filtering was not enough stringent) |
sortMatch |
(logical) if TRUE than matching will be preformed as 'match longer (of x & y) to closer', this may process slightly faster (eg 'x' longer: list for each 'y' all 'x' that are close, otherwise list of each 'x'), |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a list with close matches of 'x' to given 'y', the numeric value dependes on 'sortMatch' (if FASLE then always value of 'y' otherwise of longest of x&y)
See Also
checkSimValueInSer and (from this package) .compareByDiff, for convient output countCloseToLimits
Examples
aa <- 11:14 ; bb <- c(13.1,11.5,14.3,20:21)
findCloseMatch(aa,bb,com="diff",lim=0.6)
findCloseMatch(c(a=5,b=11,c=12,d=18),c(G=2,H=11,I=12,J=13)+0.5, comp="diff", lim=2)
findCloseMatch(c(4,5,11,12,18),c(2,11,12,13,33)+0.5, comp="diff", lim=2)
findCloseMatch(c(4,5,11,12,18),c(2,11,12,13,33)+0.5, comp="diff", lim=2, sort=FALSE)
.compareByDiff(list(c(a=10,b=11,c=12,d=13),c(H=11,I=12,J=13,K=33)+0.5),limit=1) #' return matrix
a2 <- c(11:20); names(a2) <- letters[11:20]
b2 <- c(25:5)+c(rep(0,5),(1:10)/50000,rep(0,6)); names(b2) <- LETTERS[25:5]
which(abs(b2-a2[8]) < a2[8]*1e-6*5) #' find R=18 : no10
findCloseMatch(a2, b2, com="ppm", lim=5) #' find Q,R,S,T
findCloseMatch(a2, b2, com="ppm", lim=5,asI=TRUE) #' find Q,R,S,T
findCloseMatch(b2, a2, com="ppm", lim=5,asI=TRUE,sort=FALSE)
findCloseMatch(a2, b2, com="ratio", lim=1.000005) #' find Q,R,S,T
findCloseMatch(a2, b2, com="diff", lim=0.00005) #' find S,T
Find Group-Names In Pairwise Combined And Isolate Separator
Description
This function allows mapping which group-names are occuring either as head or as tail in pairwise combined terms (by checking from tails).
Usage
findHeadAndTail(
grpNa,
pairwNa,
reportAs = "list",
sortGrp = TRUE,
rmAmbig = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
grpNa |
(character) the names of the groups of replicates (ie conditions) used to test |
pairwNa |
(character) the names of pairwise-testing (ie 'concatenated' |
reportAs |
(character) default |
sortGrp |
(logical) by default groups will be sorted (as levels of a factor appear sorted) |
rmAmbig |
(logical) remove all ambiguous |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
This function aims identifying the separator used wo create pairwise comparison labels by looking for given group-names at head and tail of combined labels. If labeles occur inside oyther ones (eg 'AB' in 'ABC') it will always privilidge the longest one. After stripping off all group-names the remaining charachers are considered as the separator used. The function will also check if all pairwise labels returned the same separtator and in case of multiple separators found the most frequent may be reytained.
Value
This function returns a list containing $sep a character vector of the separator(s) identified
See Also
(for running multiple pair-wise test) moderTestXgrp, used underneith grep
Examples
findHeadAndTail(LETTERS[4:2], c("D-X","D-C"))
grp1 <- c("C","ACC","CC","B.B","B.BA","B","CA")
pwNa1 <- "B.B-CC"
findHeadAndTail(grp1, pwNa1)
pwNa2 <- c("B.B-CC", "CA-ACC")
findHeadAndTail(grp1, pwNa2)
Find Repeated Elements
Description
This function gets index of repeated items/values in vector 'x' (will be treated as character).
It returns (named) list of indexes for each of the repeated values, or NULL if all values are unique.
This approach is similar but more basic compared to get1stOfRepeatedByCol.
Usage
findRepeated(
x,
nonRepeated = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
character vector |
nonRepeated |
(logical) if |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a (named) list of indexes for each of the repeated values, or NULL if all values unique
See Also
similar approach but more basic than get1stOfRepeatedByCol
Examples
aa <- c(11:16,14:12,14); findRepeated(aa)
Find Similar Numeric Values From Two Vectors/Matrixes
Description
This function compares to vectors or matrixes and returns combined view including only all close (by findCloseMatch).
Return matrix (predMatr) with add'l columns for index to and 'grp' (group of similar values (1-to-many)), 'nGrp' (n of grp), 'isBest' or 'nBest', 'disToMeas'
(distance/difference between pair) & 'ppmToPred' (distance in ppm).
Note: too wide 'limitComp' will result in large window and many 'good' hits will compete (and be mutually exlcuded) if selection 'bestOnly' is selected
Usage
findSimilFrom2sets(
predMatr,
measMatr,
colMeas = 1,
colPre = 1,
compareTy = "diff",
limitComp = 0.5,
bestOnly = FALSE,
silent = FALSE,
callFrom = NULL,
debug = FALSE
)
Arguments
predMatr |
(matrix or numeric vector) dataset number 1, referred to as 'predicted', the colum speified in argument |
measMatr |
(matrix or numeric vector) dataset number 2, referred to as 'measured', the colum speified in argument |
colMeas |
(integer) which column number of 'measMatr' to consider |
colPre |
(integer) which column number of 'predMatr' to consider |
compareTy |
(character) 'diff' (difference) 'ppm' (relative difference) |
limitComp |
(numeric) limit used by 'compareTy' |
bestOnly |
(logical) allows to filter only hits with min distance (defined by 'compareTy'), 3rd last col will be 'nBest' - otherwise 3rd last col 'isBest' |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) for bug-tracking: more/enhanced messages |
Value
This function returns a matrix (predMatr) with add'l columns for index to and 'grp' (group of similar values (1-to-many)), 'nGrp' (n of grp), 'isBest' or 'nBest', 'disToMeas' (distance/difference between pair) & 'ppmToPred' (distance in ppm)
See Also
checkSimValueInSer findCloseMatch closeMatchMatrix
Examples
aA <- c(11:17); bB <- c(12.001,13.999); cC <- c(16.2,8,9,12.5,12.6,15.9,14.1)
aZ <- matrix(c(aA,aA+20),ncol=2,dimnames=list(letters[1:length(aA)],c("aaA","aZ")))
cZ <- matrix(c(cC,cC+20),ncol=2,dimnames=list(letters[1:length(cC)],c("ccC","cZ")))
findCloseMatch(cC,aA,com="diff",lim=0.5,sor=FALSE)
findSimilFrom2sets(aA,cC)
findSimilFrom2sets(cC,aA)
findSimilFrom2sets(aA,cC,best=FALSE)
findSimilFrom2sets(aA,cC,comp="ppm",lim=5e4,deb=TRUE)
findSimilFrom2sets(aA,cC,comp="ppm",lim=9e4,bestO=FALSE)
# below: find fewer 'best matches' since search window larger (ie more good hits compete !)
findSimilFrom2sets(aA,cC,comp="ppm",lim=9e4,bestO=TRUE)
Select Groups Within Given Range
Description
This function aims to help finding stretches/segments of data with a given maximum number of NA-instances.
Usage
findUsableGroupRange(
dat,
grp,
maxNA = 1,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat |
(matrix or data.frame) main input |
grp |
(factor) information which column of 'dat' is replicate of whom |
maxNA |
(interger) max number of tolerated NAs |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
To find groups within a specific range, this function searches independently each line of the input-matrix 'dat' for sretches with a given maximum of NA-instances ('maxNA').
This function is used to inspect/filter each lines of 'dat' for a subset with sufficient presence/absence of NA values (ie limit number of NAs per level of 'grp').
Note : optimal perfomance with n.lines >> n.groups
Value
This function returns a matrix with boundaries of 1st and last usable column (NA if there were no suitable groups found)
Examples
dat1 <- matrix(1:56, ncol=7)
dat1[c(2,3,4,5,6,10,12,18,19,20,22,23,26,27,28,30,31,34,38,39,50,54)] <- NA
rownames(dat1) <- letters[1:nrow(dat1)]
findUsableGroupRange(dat1, gl(3,3)[-(3:4)])
Filter matrix to keep only first of repeated lines
Description
This function aims to reduce the complexity of a matrix (or data.frame) in case column 'refCol' has multiple lines with same value.
In this case, it reduces the input-data to 1st line of redundant entries and returns a matrix (or data.frame) without lines identified as redundant entries for 'refCol').
in sum, this functions works lile useng unique on a given column, and propagates the same treatment to all other columns.
Usage
firstLineOfDat(dat, refCol = 2, silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
dat |
(matrix or data.frame) main input |
refCol |
(integer) column number of reference-column |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
matrix (same number of columns as input)
See Also
firstOfRepeated, unique, duplicated
Examples
(mat1 <- matrix(c(1:6,rep(1:3,1:3)),ncol=2,dimnames=list(letters[1:6],LETTERS[1:2])))
firstLineOfDat(mat1)
Reduce To First Occurance Of Repeated Lines
Description
This function concatenattes all columns of input-matrix and then searches like unique for unique elements, optionally the indexes of unique elements may get returned.
Note: This function reats input as character (thus won't understand 10==10.0 ).
Returns simplified/non-redundant vector/matrix (ie fewer lines), or respective index.
faster than firstOfRepeated
Usage
firstOfRepLines(
mat,
outTy = "ind",
useCol = NULL,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
mat |
initial matrix to treat |
outTy |
for output type: 'ind'.. index to 1st occurance (non-red),'orig'..non-red lines of mat, 'conc'.. non-red concateneted values, 'num'.. index to which group/category the lines belong |
useCol |
(integer) custom choice of which columns to paste/concatenate |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a simplified/non-redundant vector/matrix (ie fewer lines for matrix), or respective index
See Also
unique, nonAmbiguousNum, faster than firstOfRepeated which gives more detail in output (lines/elements/indexes of omitted)
Examples
mat <- matrix(c("e","n","a","n","z","z","n","z","z","b",
"","n","c","n","","","n","","","z"),ncol=2)
firstOfRepLines(mat,out="conc")
Find first of repeated elements
Description
This function works similar to unique, but provides additional information about which elements of original input 'x' are repeatd by providing indexes realtoe to the input.
firstOfRepeated makes list with 3 elements : $indRepeated.. index for first of repeated 'x', $indUniq.. index of all unique + first of repeated, $indRedund.. index of all redundant entries, ie non-unique (wo 1st).
Used for reducing data to non-redundant status, however, for large numeric input the function nonAmbiguousNum() may perform better/faster.
NAs won't be considered (NAs do not appear in reported index of results), see also firstOfRepLines() .
Usage
firstOfRepeated(x, silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
x |
(charcter or numeric) main input |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of message(s) produced |
Value
list with indices: $indRepeated, $indUniq, $indRedund
See Also
duplicated, nonAmbiguousNum, firstOfRepLines gives less detail in output (lines/elements/indexes of omitted not directly accessible) and works fsster
Examples
x <- c(letters[c(3,2:4,8,NA,3:1,NA,5:4)]); names(x) <- 100+(1:length(x))
firstOfRepeated(x)
x[firstOfRepeated(x)$indUniq] # only unique with names
Fuse annotation matrix to initial matrix
Description
In a number of instances experimental measurements and additional information (annotation) are provided by separate objects (matrixes) as they may not be generated the same time.
The aim of this function is provide help when matching approprate lines for 2 sets of data (experimental measures in iniTab and annotation from annotTab) for fusing.
fuseAnnotMatr adds suppelmental columns/annotation to an initial matrix iniTab : using column 'refIniT' as key (in iniTab) to compare with key 'refAnnotT' (from 'annotTab').
The columns to be added from annotTab must be chosen explicitely.
Note: if non-unique IDs in iniTab : runs slow (but save) due to use of loop for each unique ID.
Usage
fuseAnnotMatr(
iniTab,
annotTab,
refIniT = "Uniprot",
refAnnotT = "combName",
addCol = c("ensembl_gene_id", "description", "geneName", "combName"),
debug = TRUE,
silent = FALSE,
callFrom = NULL
)
Arguments
iniTab |
(matrix), that may have lines with multiple (=repeated) key entries |
annotTab |
(matrix) containing reference annotation |
refIniT |
(character) type of reference (eg 'Uniprot') |
refAnnotT |
(character) column name to use for reference-annotation |
addCol |
(character) column-namess of 'annotTab' to use/extract (if no matches found, use all) |
debug |
(logical) for bug-tracking: more/enhanced messages |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of message(s) produced |
Value
This function returns a combined matrix (elements not found in 'annotTab' are displayed as NA)
See Also
Examples
tab0 <- matrix(rep(letters[1:25],8),ncol=10)
tab1 <- cbind(Uniprot=paste(tab0[,1],tab0[,2]),col1=paste(tab0[,3],
tab0[,4],tab0[,5]," ",tab0[,7],tab0[,6]))
tab2 <- cbind(combName=paste(tab0[,1],tab0[,2]),col2=paste(tab0[,8],tab0[,9],tab0[,10]))
fuseAnnotMatr(tab1,tab2[c(20:11,2:5),],refIni="Uniprot",refAnnotT="combName",addCol="col2")
fuseAnnotMatr(tab2[c(20:11,2:5),],tab1,refAnnotT="Uniprot",refIni="combName",addCol="col1")
Fuse content of list-elements with redundant (duplicated) names
Description
This function fuses (character or numeric) elements of list re-occuring under same name, so that resultant list has unique names. Note : Will not work with list of matrixes
Usage
fuseCommonListElem(
lst,
initOrd = TRUE,
removeDuplicates = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
lst |
(list) main input, list of numeric vectors |
initOrd |
(logical) preserve initial order in output (if TRUE) or otherwise sort alphabetically |
removeDuplicates |
(logical) allow to remove duplicate entries (if vector contains names, both the name and the value need to be identical to be removed; note: all names must have names with more than 0 characters to be considered as names) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a fused list (same names as elements of input)
See Also
Examples
val1 <- 10 +1:26
names(val1) <- letters
lst1 <- list(c=val1[3:6],a=val1[1:3],b=val1[2:3],a=val1[12],c=val1[13])
fuseCommonListElem(lst1)
Fuse pairs to generate cluster-names
Description
Fuse previously identified pairs to 'clusters', return vector with cluster-numbers.
Usage
fusePairs(
datPair,
refDatNames = NULL,
inclRepLst = FALSE,
maxFuse = NULL,
debug = FALSE,
silent = TRUE,
callFrom = NULL
)
Arguments
datPair |
2-column matrix where each line represents 1 pair |
refDatNames |
(NULL or character) allows placing selected pairs in context of larger data-set (names to match those of 'datPair') |
inclRepLst |
(logical) if TRUE, return list with 'clu' (clu-numbers, default output) and 'refLst' (list of clustered elements, only n>1) |
maxFuse |
(integer, default NULL) maximal number of groups/clusters |
debug |
(logical) display additional messages for debugging |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of message(s) produced |
Value
This function returns a vector with cluster-numbers
Examples
daPa <- matrix(c(1:5,8,2:6,9), ncol=2)
fusePairs(daPa, maxFuse=4)
Get First Of Repeated By Column
Description
get1stOfRepeatedByCol sorts matrix 'mat' and extracts only 1st occurance of values in column 'sortBy'.
Returns then non-redundant matrix (ie for column 'sortBy', if 'markIfAmbig' specifies existing col, mark ambig there).
Note : problem when sortSupl or sortBy not present (or not intended for use)
Usage
get1stOfRepeatedByCol(
mat,
sortBy = "seq",
sortSupl = "ty",
asFirstLast = c("full", "inter"),
markIfAmbig = c("ambig", "seqNa"),
asList = FALSE,
abmiPref = "_",
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
mat |
(matrix or data.frame) numeric vector to be tested |
sortBy |
(character) column name for which elements should be made unique, numeric or character column; 'sortSupl' .. add'l colname to always select specific 1st) |
sortSupl |
(character) default="ty" |
asFirstLast |
(character,length=2) to force specific strings from coluln 'sortSupl' as first and last when selecting 1st of repeated terms, default=c("full","inter") |
markIfAmbig |
(character,length=2) 1st will be set to 'TRUE' if ambiguous/repeated, 2nd will get (heading) prefix, default=c("ambig","seqNa") |
asList |
(logical) to return list with non-redundant ('unique') and removed lines ('repeats') |
abmiPref |
(character) prefix to note ambiguous entries/terms, default="_" |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns depending on argumnet 'asList' either list with non-redundant ('unique') and removed lines ('repeats')
See Also
firstOfRepeated for (more basic) treatment of simple vector, nonAmbiguousNum for numeric use (much faster !!!)
Examples
aa <- cbind(no=as.character(1:20),seq=sample(LETTERS[1:15],20,repl=TRUE),
ty=sample(c("full","Nter","inter"),20,repl=TRUE),ambig=rep(NA,20),seqNa=1:20)
get1stOfRepeatedByCol(aa)
Identify Separator In Pairwise Group-Names Or Find Separator For Use With Pairwise Group-Names This function allows identifing separator used when pairwise groups are presented.
Description
Identify Separator In Pairwise Group-Names Or Find Separator For Use With Pairwise Group-Names
This function allows identifing separator used when pairwise groups are presented.
Usage
getPWseparator(
compNames = NULL,
grp = NULL,
potSep = c("-", "---", "_", "___", ".", "-vs-", "_vs_", "--vs--", "__vs__", " ", " ",
"--", "__"),
includeGrp = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
compNames |
(character or integer) names of pairwise combined group-names |
grp |
(character or factor) optional groups (may include group-names that do not occur in |
potSep |
(character) potential separators to be checked if occuring in |
includeGrp |
(logical) if |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
Note : Potential separators potSep must be at least 1 character long
The character '.' may used as separator (argument potSep), it will be protected internally for obtaining correct results when using grep().
Note : The indexing is relative to the levels of grp, thus to sorted group-names !
Cases of usage :
1) Identify separator used in concatenated labels, ie concatenated group-names are given, (only argument compNames is obligatory)
2) Suggets/Find suitable separator for given group-labels (ie a separator not occurring in any of the group-labels) when names
of grp given (thus argument grp is obligatory),
the first instance of potSep fitting will be chosen
Value
This function returns a character vector (length=1) of the (first) separator fitting to all data, or a list with $sep and $grpNa if includeGrp=TRUE
See Also
indexGroupsFromPW, getPWseparator, colnames of testing results from moderTestXgrp, used by replacePWseparator
Examples
## Suggest separator
getPWseparator(grp=LETTERS[1:3])
getPWseparator(grp=c("B-C","D","E"))
getPWseparator(grp=c("B-C","D","E"), includeGrp=TRUE)
## Identify separator used
getPWseparator(compNames=c("B-C","B-D","C-D"))
getPWseparator(compNames=c("B-C","B-D","C-D"), includeGrp=TRUE)
Extract Pairwise Testing Setup
Description
This function allows extacting, checking and combinig elements defining labels for pairwise comparisons.
Usage
getPairwiseSetup(
pwGrpNa,
grpNa = NULL,
sep = NULL,
combPwSep = "combine1",
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
pwGrpNa |
(character) the names of pairwise-testing (ie 'concatenated' |
grpNa |
(character) the names of the groups of replicates (ie conditions) used to test |
sep |
(NULL or character, length=1) if not |
combPwSep |
(character) sequence of separators for building combined names; may be combPwSep='combine1' or 'combine2'; will be used in pwSeparatorList() |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
This function was designed to support functions exploiting pairwise testing results like plotting functions for Volcano-Plots etc.
Initially the function will check if the object given as argument pwGrpNa is an MAarrayLM-objects object and/or was created using moderTestXgrp.
If yes, the function will try to extract names of groups, pairwise combinations and separator used from $setup, if present.
If no $setup found this function will check through several elements in MAarrayLM-objects to gather all elements needed.
2) The separator sep is given and exact matches at both sides will be searched.
However, if the character(s) from sep do appear inside pwGrpNa no matches will be found.
If some pwGrpNa are not found in grpNa this will be marked as NA.
Finally, if no testing result is given as input, basic parameters group-names, pairwise names and the separator to be used can be combined into a list.
Value
This function returns a list with $ind with matrix of indexes to (sorted) pwGrpNa for each pairwise comparison;
$pwGrpNames with matrix of pwGrpNa for each pairwise comparison;
$sep for the separator found ; $pwGrpNa which recapitulates (sorted) pwGrpNa as factor
See Also
(for running multiple pair-wise test) moderTestXgrp, convPairwiseSetup, presenceFilt, getPWseparator, indexGroupsFromPW,
(used underneith:) grep, strsplit
Examples
grp3 <- factor(rep(LETTERS[c(3,1,4)],c(2,3,3)))
set.seed(2017); t8 <- matrix(round(rnorm(208*8,10,0.4),2), ncol=8,
dimnames=list(paste(letters[],rep(1:8,each=26),sep=""), paste0(grp3, c(1:2,1:3,1:3))))
test1 <- moderTestXgrp(t8, grp3)
getPairwiseSetup(test1)
Print matrix-content as plot
Description
When data have repeated elements (defined by names inside the vector), it may be advantageous to run some operations
only on a unique set of the initial data, or somtimes all repeated occurances need to be replaced by a common (summarizing) value.
This function allows to re-introduce new values from on second vector with unique names, to return a final vector of initial input-length and order of names (elements) like initial, too.
Normally the user would provide 'datUniq' (without repeated names) containing new values which will be expanded to structure of 'dat',
if 'datUniq' is not provided a vector with unique names will be made using the first occurance of repeated value(s).
For more complex cases the indexing relative to 'datUniq' can be returned (setting asIndex=TRUE).
Note: If not all names of 'dat' are found in 'datUniq' the missing spots will be returned as NA.
Usage
getValuesByUnique(
dat,
datUniq = NULL,
asIndex = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat |
(numeric or character) main long input, must have names |
datUniq |
(numeric or character) will be used to impose values on |
asIndex |
(logical) if |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
vector of length dat with imposed values, or index values if asIndex=TRUE
See Also
unique, findRepeated, correctToUnique, treatTxtDuplicates
Examples
dat <- 11:19
names(dat) <- letters[c(6:3,2:4,8,3)]
## let's make a 'datUniq' with the mean of repeated values :
datUniq <- round(tapply(dat,names(dat),mean),1)
## now propagate the mean values to the full vector
getValuesByUnique(dat,datUniq)
cbind(ini=dat,firstOfRep=getValuesByUnique(dat,datUniq),
indexUniq=getValuesByUnique(dat,datUniq,asIn=TRUE))
Convert GitHub Url-Name For Reading In Raw-Mode
Description
This functions converts a given urlName so that (tabular) data from GitHub (https://github.com/) can data be read correctly as tabular data.
Usage
gitDataUrl(
urlName,
replTxt = NULL,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
urlName |
(charachter) main url-address |
replTxt |
(NULL or matrix) adjust/ custom-modify search- and replacement items; default settings will exchange the beginning of the site to 'raw.githubusercontent.com' and then exchange 'blob' to 'refs/head' otherwise should be matrix with 2 columns, the 1st colimn entries will be used as 'search-for' and the 2nd as 'replace by' for each row |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
Thus, this will exchange the beginning of the site to 'raw.githubusercontent.com' and then exchange 'blob' to 'refs/head' . Alternatively, the user may custom define all terms to get exchanged (as matrix with 2 columns 'old' and 'new').
Note : The default spearator from read.delim may suit better for reading the data.
Value
corrected urlName
See Also
Examples
url1 <- paste0("https://github.com/bigbio/proteomics-metadata-standard/blob/",
"main/datasets/PXD001819/PXD001819.sdrf.tsv")
rbind(ini=url1, new=gitDataUrl(url1))
Html Special Character Conversion
Description
Converts 'txt' so that (the most common) special characters (like 'beta','micro','square' etc) will be displayed correctly whe used for display in html (eg at mouse-over).
Note : The package stringi is required for the conversions (the input will get returned if stringi is not available).
Currently only the 16 most common special characters are implemented.
Usage
htmlSpecCharConv(txt, silent = FALSE, callFrom = NULL, debug = FALSE)
Arguments
txt |
character vector, including special characters |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) additional messages for debugging |
Value
This function returns a corrected character vector adopted for html display
See Also
tables on https://www.htmlhelp.com/reference/html40/entities/latin1.html,
https://www.degraeve.com/reference/specialcharacters.php, or https://ascii.cl/htmlcodes.htm
Examples
## we'll use the package stringi to generate text including the 'micro'-symbol as input
x <- if(requireNamespace("stringi", quietly=TRUE)) {
stringi::stri_unescape_unicode("\\u00b5\\u003d\\u0061\\u0062")} else "\"x=axb\""
htmlSpecCharConv(x)
Index Names Of Groups From Vector Of Concatenated Pairwise Group-Names
Description
This function allows matching which groups are cited in a pairwise concatenated manner.
This function can also be used to split concatenated group-names (while automatically determining a suitable separator) and display as matrix when includeGrp=TRUE.
Replaces matchSampToPairw() ???
Usage
indexGroupsFromPW(
compNames,
grp = NULL,
potSep = pwSeparatorList("combine1"),
includeGrp = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
compNames |
(vector of character or integer, or matrix) names of pairwise combined group-names; if matrix the rownames of |
grp |
(character or factor) optional groups (may include group-names that do not occur in |
potSep |
(character) potential separators to be checked if occuring in |
includeGrp |
(logical) instead of matrix, rather return list with $pwInd, $pwGrpNames (group-names corresponding to index), $sep (separator used to split) and $grpNa |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a numeric matrix with indexes corresponding to (sorted) group-names as they appear in compNames;
or if includeGrp=TRUE a list with $ind (matrix indexes for each compNames), $grpNames (group-names corresponding to index), $sep (separator used to split) and $grpNa (sorted names of types of groups)
See Also
moderTestXgrp (colnames of testing results from this function may be used); replacePWseparator; used internally getPWseparator, pwSeparatorList, .getPWseparator
Examples
indexGroupsFromPW(c("C-B","B-D","C-D"))
indexGroupsFromPW(c("C-B","B-D","C-D"), grp=rep(LETTERS[1:6],2), includeGrp=TRUE)
Extract Longest Common Text Out Of Character Vector
Description
This function allows recovering the single longest common text-fragments (from center, head or tail) out of character vector txt.
Only the first of all of the longest solutions will be returned.
Usage
keepCommonText(
txt,
minNchar = 1,
side = "center",
hiResol = TRUE,
silent = TRUE,
callFrom = NULL,
debug = FALSE
)
Arguments
txt |
character vector to be treated |
minNchar |
(integer) minumin number of characters that must remain |
side |
(character) may be be either 'center', 'any', 'terminal', 'left' or 'right'; only with |
hiResol |
(logical) find best solution, but at much higher comptational cost (eg 3x slower, however |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) display additional messages for debugging |
Details
Please note, that finding common parts between chains of characters is not a completely trivial task. This topic still has ongoing research for the application of sequence-alignments, where chains of characters to be compared get very long. This function uses a k-mer inspirated approach. The initial aim with this function was allowing to treat smaller chains of characters (and finding shorter strteches of common text), like eg with column-names.
Important : This function identifies only the first best hit, ie other shared/common character-chains of the same length will not be found !
Using the argument hiResol=FALSE it is possible to accelerate the search aprox 3x (with larger character-vectors), however, frequently the very best solution may not be found.
This means, that in this case the result should rather be considered a 'seed', allowing check if further extension may improve the result,
ie for identifying a (slightly) longer chain of common characters.
With longer vectors and longer character chains this may get demanding on computational reesources, the argument hiResol=FALSE allows reducing this at the price of missing the best solution.
With this argument single common/matching characters will not be searched if all text-elements are longer than 500 characters, an empty character vector will be returned.
When argument side is either left, right or terminal only terminal common text may be found (a potentially even longer internal text will be lost).
Of course, choosing this option makes searches much faster.
This function does not return the position of the shared/common characters within the text, you may use gregexpr or regexec to locate them.
Value
This function returns a character vector of length=1, ie only one (normally the longest) common sequence of characters is identified. If nothing is found common/shared an empty character-vector is returned
See Also
Use gregexpr or regexec in grep for locating the identified common characters in the initial query.
Inverse : Trim redundant text (from either side) to keep only varaible part using trimRedundText;
you may also look for related functions in package stringr
Examples
txt1 <- c("abcd_abc_kjh", "bcd_abc123", "cd_abc_po")
keepCommonText(txt1, side="center") # trim from right
txt2 <- c("ddd_ab","ddd_bcd","ddd_cde")
trimRedundText(txt2, side="left") #
keepCommonText(txt2, side="center") #
Transform (factor) levels into index
Description
This function helps transforming a numeric or character vector into indexes of levels (of its original values).
By default indexes are assigned by order of occurance, ie, the first value of x will be get the index of 1.
Using the argument byOccurance=FALSE the resultant indexes will follow the sorted values.
Usage
levIndex(
dat,
byOccurance = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat |
(numeric or character vector or factor) main input |
byOccurance |
(logical) toogle if lowest index should be based on alphabetical order or on order of input |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
matrix with mean values
See Also
Examples
x1 <- letters[rep(c(5,2:3),1:3)]
levIndex(x1)
levIndex(x1, byOccurance=FALSE)
## with factor
fa1 <- factor(letters[rep(c(5,2:3),1:3)], levels=letters[1:6])
levIndex(fa1)
levIndex(fa1, byOccurance=FALSE)
Test Multiple Starting Levels For Linear Regression Model, Select Best And Plot
Description
The aim of this function is to select the data suiting set of levels on the main input data to construct a linear regression model.
Usage
linModelSelect(
rowNa,
dat,
expect,
logExpect = FALSE,
startLev = NULL,
lisNa = c(raw = "raw", annot = "annot", datImp = "datImp"),
plotGraph = TRUE,
tit = NULL,
pch = c(1, 3),
cexLeg = 0.95,
cexSub = 0.85,
xLab = NULL,
yLab = NULL,
cexXAxis = 0.85,
cexYAxis = 0.9,
xLabLas = 1,
cexLab = 1.1,
suppressWarnings = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
rowNa |
(character or numeric, length=1) if |
dat |
(matrix, list or MArrayLM-object from limma) main input of which columns should get re-ordered, may be output from |
expect |
(numeric of character) the expected levels; if character, constant unit-characters will be stripped away to extact the numeric content |
logExpect |
(logical) toggle to |
startLev |
(integer) specify all starting levels to test for omitting here (multiple start sites for modelling linear regression may be specified to finally pick the best model) |
lisNa |
(character) in case |
plotGraph |
(logical) display figure |
tit |
(character) optional custom title |
pch |
(integer) symbols to use n optional plot; 1st for regular values, 2nd for values not used in regression |
cexLeg |
(numeric) size of text in legend |
cexSub |
(numeric) text-size for line (as subtitle) giving regression details of best linear model) |
xLab |
(character) custom x-axis label |
yLab |
(character) custom y-axis label |
cexXAxis |
(character) |
cexYAxis |
(character) |
xLabLas |
(integer) |
cexLab |
(numeric) |
suppressWarnings |
(logical) suppress warnings from lm() that may appear when NAs get introduced |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
In real world measurements one may be confronted to the case of very low level analytes below the detection limit (LOD) and resulting read-outs fluctuate around around a common baseline (instead of NA).
With such data it may be preferable to omit the read-outs for the lowest concentrations/levels of analytes if they are spread around a base-line value.
This function allows trying to omit all starting levels designed in startLev, then the resulting p-values for the linear regression slopes will be checked and the best p-value chosen.
The input may also be a MArrayLM-type object from package limma or from moderTestXgrp or moderTest2grp.
In the graphical representation all points assocoated to levels omitted are shown in light green.
For the graphical display additional information can be used : If the dat is list or MArrayLM-type object,
the list-elements $raw (according to argument lisNa will be used to display points initially given as NA ad imputed lateron in grey.
Logarithmic (ie log-linear) data can be treated by settting argument logExpect=TRUE. Then the levels will be taken as exponent of 2 for the regression, while the original values will be displayed in the figure.
Value
This function returns a list with $coef (coefficients), $name (as/from input rowNa), $startLev the best starting level)
See Also
moderTestXgrp for single comparisons, order
Examples
## Construct data
li1 <- rep(c(4,3,3:6),each=3) + round(runif(18)/5,2)
names(li1) <- paste0(rep(letters[1:5], each=3), rep(1:3,6))
li2 <- rep(c(6,3:7), each=3) + round(runif(18)/5, 2)
dat2 <- rbind(P1=li1, P2=li2)
exp2 <- rep(c(11:16), each=3)
## Check & plot for linear model
linModelSelect("P2", dat2, expect=exp2)
## Log-Linear data
## Suppose dat2 is result of measures in log2, but exp4 is not
exp4 <- rep(c(3,10,30,100,300,1000), each=3)
linModelSelect("P2", dat2, expect=exp4, logE=FALSE) # bad
linModelSelect("P2", dat2, expect=exp4, logE=TRUE)
Fit linear regression, return parameters and p-values
Description
This function fits a linear regression and returns the parameters, including p-values from Anova.
Here the vector 'y' (scalar response or dependent variable, ie the value that should get estimated) will be estimated according to 'dep' (explanatory or independent variable).
Alternatively, 'dep' may me a matrix where 1st column will be used as 'dep and the 2nd column as 'y'.
Usage
linRegrParamAndPVal(
dep,
y = NULL,
asVect = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dep |
(numeric vector, matrix or data.frame) explanatory or dependent variable, if matrix or data.frame the 1st column will be used, if 'y'= |
y |
(numeric vector) independent variable (the value that should get estimated based on 'dep') |
asVect |
(logical) return numeric vector (Intercept, slope, p.intercept, p.slope) or matrix or results |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
numeric vector (Intercept, slope, p.intercept, p.slope), or if asVect==TRUE as matrix (p.values in 2nd column)
See Also
Examples
linRegrParamAndPVal(c(5,5.1,8,8.2),gl(2,2))
Replacements in list
Description
listBatchReplace replaces in list lst all entries with value searchValue by replaceBy
Usage
listBatchReplace(
lst,
searchValue,
replaceBy,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
lst |
input-list to be used for replacing |
searchValue |
(character, length=1) |
replaceBy |
(character, length=1) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a corrected list
See Also
basic replacement sub in grep
Examples
lst1 <- list(aa=1:4, bb=c("abc","efg","abhh","effge"), cc=c("abdc","efg"))
listBatchReplace(lst1, search="efg", repl="EFG", sil=FALSE)
Organize Values Into List And Sort By Names
Description
Sort values of 'x' by its names and organize as list by common names, the names until 'sep' are used for (re)grouping.
Note that typical spearators occuring the initial names may need protection by '\' (this is automatically taken care of for the case of the dot ('.') separator).
Usage
listGroupsByNames(x, sep = ".", silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
x |
(list) main input |
sep |
(character) separator (note that typcal separators may need to be protected, only automatically added for '.') |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a matrix or data.frame
See Also
rbind in cbind
Examples
listGroupsByNames((1:10)/5)
ser1 <- 1:6; names(ser1) <- c("AA","BB","AA.1","CC","AA.b","BB.e")
listGroupsByNames(ser1)
Run lm on segmented data (from clustering)
Description
lmSelClu runs linear regression on data segmented previously (eg by clustering).
This functio offers various types of (2-coefficient) linear regression on 2 columns of 'dat' (matrix with 3rd col named 'clu' or 'cluID', numeric elements for cluster-number).
If argument 'clu' is (default) 'max', the column 'clu' will be inspected to take most frequent value of 'clu', otherwise a numeric entry specifying the cluster to extract is expected.
Note: this function was initially made for use with results from diagCheck()
Note: this function lacks means of judging godness of fit of the regression preformed & means for plotting
Usage
lmSelClu(
dat,
useCol = 1:2,
clu = "max",
regTy = "lin",
filt1 = NULL,
filt2 = NULL,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat |
matrix or data.frame |
useCol |
(integer or charcter) specify which 2 columns of 'dat' to use for linear regression |
clu |
(character) name of cluster to be extracted and treatad |
regTy |
(character) change type used for linear regression : 'lin' for 1st col ~ 2nd col, 'res' for residue ~ 2nd col, 'norRes' for residue/2nd col ~2nd col or 'sqNorRes','inv' for 1st col ~ 1/(2nd col), 'invRes' for residue ~ 1/(2nd col) |
filt1 |
(logical or numerical) filter criteria for 1st of 'useCol' , if numeric then select all lines of dat less than max of filt1 |
filt2 |
(logical or numerical) filter criteria for 2nd of 'useCol' , if numeric then select all lines of dat less than max of filt2 |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
lm object (or NULL if no data left)
See Also
Examples
set.seed(2016); ran1 <- runif(220)
mat1 <- round(rbind(matrix(c(1:100+ran1[1:100],rep(1,50)),ncol=3),
matrix(c(1:60,68:9+ran1[101:160],rep(2,60)),nc=3)),1)
colnames(mat1) <- c("a","BB","clu")
lmSelClu(mat1)
plot(mat1[which(mat1[,3]=="2"),1:2],col=grey(0.6))
abline(lmSelClu(mat1),lty=2,lwd=2)
#
mat2 <- round(rbind(matrix(c(1:100+ran1[1:100],rep(1,50)),ncol=3),
matrix(c(1:60,(2:61+ran1[101:160])^2,rep(2,60)),nc=3)),1)
colnames(mat2) <- c("a","BB","clu")
(reg2 <- lmSelClu(mat2,regTy="sqNor"))
plot(function(x) coef(reg2)[2]+ (coef(reg2)[2]*x^2),xlim=c(1,70))
points(mat2[which(mat2[,3]=="2"),1:2],col=2)
rbind on lists
Description
rbind-like function to append list-elements containing matrixes (or data.frames) and return one long table. All list-elements must have same number of columns (and same types of classes in case of data.frames. Simple vectors (as list-elements) will be considered as sigle lines for attaching.
Usage
lrbind(lst, silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
lst |
(list, composed of multiple matrix or data.frames or simple vectors) main input (each list-element should have same number of columns, numeric vectors will be converted to number of columns of other columns/elements) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns (depending on input) a matrix or data.frame
See Also
rbind in cbind
Examples
lst1 <- list(matrix(1:9, ncol=3, dimnames=list(letters[1:3],c("AA","BB","CC"))),
11:13, matrix(51:56, ncol=3))
lrbind(lst1)
Make MA-List Object
Description
makeMAList extracts sets of data-pairs (like R & G series) and makes MA objects as MA-List object (eg for ratio oriented analysis).
The grouping of columns as sets of replicate-measurements is done according to argumnet MAfac.
The output is fully compatible to functions of package limma (Bioconductor).
Usage
makeMAList(
mat,
MAfac,
useF = c("R", "G"),
isLog = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
mat |
main input matrix |
MAfac |
(factor) factor orgnaizing columns of 'mat' (if |
useF |
(character) two specific factor-leves of |
isLog |
(logical) tell if data is already log2 (will be considered when computing M and A values) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
This function requires Bioconductor package limma being installed.
Value
limma-type "MAList" containing M and A values
See Also
test2factLimma, for creating RG-lists within limma: MA.RG in normalizeWithinArrays
Examples
set.seed(2017); t4 <- matrix(round(runif(40,1,9),2), ncol=4,
dimnames=list(letters[c(1:5,3:4,6:4)], c("AA1","BB1","AA2","BB2")))
makeMAList(t4, gl(2,2,labels=c("R","G")))
Make non-redundant matrix
Description
This function takes matrix or data.frame 'dat' to summarize redundant lines (column argument iniID) along method specified in summarizeRedAs
to treat all lines with redundant iniID by same approach (ie for all columns the line where specified column is at eg max = 'maxOfRef' ).
If no name given, the function will take the last numeric (factors may be used - they will be read as levels).
Usage
makeNRedMatr(
dat,
summarizeRedAs,
iniID = "iniID",
retDataFrame = TRUE,
nEqu = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat |
(matrix or data.frame) main input for making non-redundant |
summarizeRedAs |
(character) summarization method(s), typical choices 'median','mean','min' or 'maxOfRef';
basic usage like |
iniID |
(character) column-name used as reference for determining groups of redundant lines (default="iniID") |
retDataFrame |
(logical) if |
nEqu |
(logical) if |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Details
When using for selection of single initial line give the character-string of argument summarizeRedAs a name (eg summ=c(X1="minOfRef")
so that the function will use ONLY the column specified via the name for determining which line should be used/kept.
It is possible to base the choice from 'redundant' lines on a single reference-column.
For example, when summarizeRedAs='maxOfRef' summarizing of all (numeric) columns will be performed according to one single column (ie the line where the last numeric column is at its max).
Otherwiser, a name can be assigned as reference column to be used (eg see last example using summarizeRedAs=c(x1='maxOfRef'))
Value
This function returns a (numeric) matrix or data.frame with summarized data and add'l col with number of initial redundant lines
See Also
simple/partial functionality in summarizeCols, checkSimValueInSer
Examples
t3 <- data.frame(ref=rep(11:15,3),tx=letters[1:15],
matrix(round(runif(30,-3,2),1),nc=2),stringsAsFactors=FALSE)
by(t3,t3[,1],function(x) x)
t(sapply(by(t3,t3[,1],function(x) x), summarizeCols, me="maxAbsOfRef"))
# calculate mean for lines concerened of all columns :
(xt3 <- makeNRedMatr(t3, summ="mean", iniID="ref"))
# choose lines based only on content of column 'X1' (here: max):
(xt3 <- makeNRedMatr(t3, summ=c(X1="maxOfRef"), iniID="ref"))
Match All Lines of Matrix To Reference Note
Description
This function allows adjusting the order of lines of a matrix mat to a reference character-vector ref,
even when initial direct matching of character-strings using match is not possible/successful.
In this case, various variants of using grep will be used to see if unambiguous matching is possible of characteristic parts of the text.
All columns of mat will be tested an the column giving the bes resuts will be used.
Usage
matchMatrixLinesToRef(
mat,
ref,
exclCol = NULL,
addRef = TRUE,
inclInfo = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
mat |
(matrix or data.frame) main input, all columns of |
ref |
(character, length must match ) reference for trying to match each of the columns of |
exclCol |
(character or integer) column-name or -index of column to ignore/exclude when looking for matches |
addRef |
(logical), if |
inclInfo |
(logical) allows returning list with new matrix and additional information |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Details
This function tests all columns of mat to find perfect matching results to the reference ref.
In case of multiple results the
In case no direct matching is possible, grep will be used to find the best partial matching.
The orderof the rows of input mat will be adjusted according to the matching results.
If addRef=TRUE, the reference will be included as additional column to the results, too.
Value
This function returns the input matrix in an adjusted order (plus an optional additional column showing the reference)
or if inclInfo=TRUE a list with $mat (adjusted matrix), $byColumn, $newOrder and $method;
the reference can bee added as additional last column if addRef=TRUE
See Also
match, grep, trimRedundText, replicateStructure
Examples
## Note : columns b and e allow non-ambigous match, not all elements of e are present in a
mat0 <- cbind(a=c("mvvk","axxd","bxxd","vv"),b=c("iwwy","iyyu","kvvh","gxx"), c=rep(9,4),
d=c("hgf","hgf","vxc","nvnn"), e=c("_vv_","_ww_","_xx_","_yy_"))
matchMatrixLinesToRef(mat0[,1:4], ref=mat0[,5])
matchMatrixLinesToRef(mat0[,1:4], ref=mat0[1:3,5], inclInfo=TRUE)
matchMatrixLinesToRef(mat0[,-2], ref=mat0[,2], inclInfo=TRUE) # needs 'reverse grep'
Value Matching with optional reversing of sub-parts of non-matching elements
Description
This function provides a variant to match, where initially non-matching elements of x
will be tested by decomposing non-matching elements, reversing the parts in front and after the separator sep and re-matching.
If separator sep does not occur, a warning will be issued, if it occurs more than once,
the parts before and after the first separartor will be used and a warning issued.
Usage
matchNamesWithReverseParts(
x,
y,
sep = "-",
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
(character) first vector for match |
y |
(character) second vector for match |
sep |
(character) separator between elements |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
index for matching (integer) x to y
See Also
Examples
tx1 <- c("a-b","a-c","d-a","d-b","b-c","d-c")
tmp <- triCoord(4)
tx2 <- paste(letters[tmp[,1]],letters[tmp[,2]],sep="-")
## Some matches won't be found, since 'a-d' got reversed to 'd-a', etc...
match(tx1,tx1)
matchNamesWithReverseParts(tx1,tx2)
Match Names To Concatenated Pairs Of Names
Description
The column-names of multiple pairwise testing contain the names of the initial groups/conditions tested, plus there is a separator (eg '-' in moderTestXgrp).
Thus function allows to map back which groups/conditions were used by returning the index of the respective groups used in pair-wise sets.
Usage
matchSampToPairw(
grpNa,
pairwNa,
sep = NULL,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
grpNa |
(character) the names of the groups of replicates (ie conditions) used to test |
pairwNa |
(character) the names of pairwise-testing (ie 'concatenated' |
sep |
(character) if not |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
There are two modes of operation : 1) Argument sep is set to NULL : The names of initial groups/conditions (grpNa)
will be tested for exact pattern matching either at beginning or at end of pair-wise names (pairwNa).
This approach has the advantage that it does not need to be known what character(s) were used as separator (or they may change),
but the disadvantage that in case the perfect grpNa was not given, the longest best match of grpNa will be returned.
2) The separator sep is given and exact matches at both sides will be searched.
However, if the character(s) from sep do appear inside grpNa no matches will be found.
If some grpNa are not found in pairwNa this will be marked as NA.
This function checks also if a double version of sep may fit better to grpNa
and will adjust sep accordingly (eg adjust sep='-' to '–').
Value
This function returns a matrix of 2 columns with inidices of sampNa with pairwNa as rows
See Also
(for running multiple pair-wise test) moderTestXgrp, grep, strsplit
Examples
pairwNa1 <- c("abc-efg","abc-hij","efg-hij")
grpNa1 <- c("hij","abc","abcc","efg","klm")
matchSampToPairw(grpNa1, pairwNa1)
pairwNa2 <- c("abc-efg","abcc-hij","abc-hij","abc-hijj","zz-zz","efg-hij")
matchSampToPairw(grpNa1, pairwNa2)
Transform columns of matrix to list of vectors
Description
convert matrix to list of vectors: each column of 'mat' as vector of list
Usage
matr2list(mat, concSym = ".", silent = FALSE, debug = TRUE, callFrom = NULL)
Arguments
mat |
(matrix) main input |
concSym |
(character) symbol for concatenating: concatenation of named vectors in list names as colname(s)+'concSym'+rowname |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
matrix or array (1st dim is intraplate-position, 2nd .. plate-group/type, 3rd .. channels)
See Also
Examples
mat1 <- matrix(1:12,ncol=3,dimnames=list(letters[1:4],LETTERS[1:3]))
mat2 <- matrix(LETTERS[11:22],ncol=3,dimnames=list(letters[1:4],LETTERS[1:3]))
matr2list(mat1); matr2list(mat2)
Merge Multiple Matrices
Description
This function allows merging of multiple matrix-like objects.
The matix-rownames will be used to align common elements, either be returning all common elements mode='intersect' or containg all elements mode='union' (the result may contains additional NAs).
Usage
mergeMatrices(
...,
mode = "intersect",
useColumn = 1,
na.rm = TRUE,
extrRowNames = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
... |
(matrix or data.frame) multiple matrix or data.frame objects may be entered |
mode |
(character) allows choosing restricting to all common elements ( |
useColumn |
(integer, character or list) the column(s) to consider, may be |
na.rm |
(logical) suppress |
extrRowNames |
(logical) decide whether columns with all values different (ie no replicates or max divergency) should be excluded |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
Custom column-names can be given by entering matrices like named arguments (see examples below).
The choice of columns tu use may be adopted to each matrix entered, in this case the argument useColumn may be a list with matrix-names to use or a list of indexes (see examples below).
Note, that matrices may contain repeated rownames (see examples, mat3). In this case only the first of repeated rownames will be considered (and lines of repeated names ignored).
Value
This function returns a matrix containing all selected columns of the input matrices to fuse
See Also
Examples
mat1 <- matrix(11:18, ncol=2, dimnames=list(letters[3:6],LETTERS[1:2]))
mat2 <- matrix(21:28, ncol=2, dimnames=list(letters[2:5],LETTERS[3:4]))
mat3 <- matrix(31:38, ncol=2, dimnames=list(letters[c(1,3:4,3)],LETTERS[4:5]))
mergeMatrices(mat1, mat2)
mergeMatrices(mat1, mat2, mat3, mode="union", useCol=2)
## custom names for matrix-origin
mergeMatrices(m1=mat1, m2=mat2, mat3, mode="union", useCol=2)
## flexible/custom selection of columns
mergeMatrices(m1=mat1, m2=mat2, mat3, mode="union", useCol=list(1,1:2,2))
Merge Multiple Matrices from List
Description
This function allows merging of multiple matrix-like objects from an initial list.
The matix-rownames will be used to align common elements, either be returning all common elements mode='intersect' or containg all elements mode='union' (the result may contains additional NAs).
Usage
mergeMatrixList(
matLst,
mode = "intersect",
useColumn = 1,
na.rm = TRUE,
extrRowNames = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
matLst |
(list containing matrices or data.frames) main input (multiple matrix or data.frame objects) |
mode |
(character) allows choosing restricting to all common elements ( |
useColumn |
(integer, character or list) the column(s) to consider, may be |
na.rm |
(logical) suppress |
extrRowNames |
(logical) decide whether columns with all values different (ie no replicates or max divergency) should be excluded |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
Custom column-names can be given by entering matrices like named arguments (see examples below).
The choice of columns tu use may be adopted to each matrix entered, in this case the argument useColumn may be a list with matrix-names to use or a list of indexes (see examples below).
Note, that matrices may contain repeated rownames (see examples, mat3). In this case only the first of repeated rownames will be considered (and lines of repeated names ignored).
Value
This function returns a matrix containing all selected columns of the input matrices to fuse
See Also
merge, mergeMatrices for separate entries
Examples
mat1 <- matrix(11:18, ncol=2, dimnames=list(letters[3:6],LETTERS[1:2]))
mat2 <- matrix(21:28, ncol=2, dimnames=list(letters[2:5],LETTERS[3:4]))
mat3 <- matrix(31:38, ncol=2, dimnames=list(letters[c(1,3:4,3)],LETTERS[4:5]))
mergeMatrixList(list(mat1, mat2))
mergeMatrixList(list(m1=mat1, m2=mat2, mat3), mode="union", useCol=2)
Merge selected columns out of 2 matrix or data.frames
Description
This function merges selected columns out of 2 matrix or data.frames. 'selCols' will be used to define columns to be used; optionally may be different for 'dat2' : define in 'supCols2'. Output-cols will get additions specified in newSuff (default '.x' and '.y')
Usage
mergeSelCol(
dat1,
dat2,
selCols,
supCols2 = NULL,
byC = NULL,
useAll = FALSE,
setRownames = TRUE,
newSuff = c(".x", ".y"),
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat1 |
matrix or data.frame for fusing |
dat2 |
matrix or data.frame for fusing |
selCols |
will be used to define columns to be used; optionally may be different for 'dat2' : define in 'supCols2' |
supCols2 |
if additional column-names should be extracted form dat2 |
byC |
(character) 'by' value used in |
useAll |
(logical) use all lines (will produce NAs when given identifyer not found un 2nd group of data) |
setRownames |
(logical) if |
newSuff |
(character) prefix (argument 'suffixes' in |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a data.frame containing the merged columns
See Also
merge, merge 3 data.frames using mergeSelCol3
Examples
mat1 <- matrix(c(1:7,letters[1:7],11:17), ncol=3, dimnames=list(LETTERS[1:7],c("x1","x2","x3")))
mat2 <- matrix(c(1:6,c("b","a","e","f","g","k"), 31:36),
ncol=3, dimnames=list(LETTERS[11:16],c("y1","x2","x3")))
mergeSelCol(mat1, mat2, selC=c("x2","x3"))
mergeSelCol3
Description
successive merge of selected columns out of 3 matrix or data.frames. 'selCols' will be used to define columns to be used; optionally may be different for 'dat2' : define in 'supCols2'. Output-cols will get additions specified in newSuff (default '.x' and '.y')
Usage
mergeSelCol3(
dat1,
dat2,
dat3,
selCols,
supCols2 = NULL,
supCols3 = NULL,
byC = NULL,
useAll = FALSE,
setRownames = TRUE,
newSuff = c(".x", ".y", ".z"),
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat1 |
matrix or data.frame for fusing |
dat2 |
matrix or data.frame for fusing |
dat3 |
matrix or data.frame for fusing |
selCols |
will be used to define columns to be used; optionally may be different for 'dat2' : define in 'supCols2' |
supCols2 |
if additional column-names should be extracted form dat2 |
supCols3 |
if additional column-names should be extracted form dat3 |
byC |
(character) 'by' value used in |
useAll |
(logical) use all lines (will produce NAs when given identifyer not found un 2nd group of data) |
setRownames |
if |
newSuff |
(character) prefix (argument 'suffixes' in |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a data.frame containing the merged columns
See Also
Examples
mat1 <- matrix(c(1:7,letters[1:7],11:17),ncol=3,dimnames=list(LETTERS[1:7],c("x1","x2","x3")))
mat2 <- matrix(c(1:6,c("b","a","e","f","g","k"),31:36), ncol=3,
dimnames=list(LETTERS[11:16],c("y1","x2","x3")))
mat3 <- matrix(c(1:6,c("c","a","e","b","g","k"),51:56), ncol=3,
dimnames=list(LETTERS[11:16],c("z1","x2","x3")))
mergeSelCol3(mat1, mat2, mat3, selC=c("x2","x3"))
Merge Named Vectors
Description
This function allows merging for multiple named vectors (each element needs to be named).
Basically, all elements carrying the same name across different input-vectors will be aligned in the same column of the output (input-vectors appear as lines).
If vectors are not given using a name (see first example below), they will be names 'x.1' etc (see argument namePrefix).
Usage
mergeVectors(
...,
namePrefix = "x.",
NAto0 = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
... |
all vectors that need to be merged |
namePrefix |
(character) prefix to numers used when vectors are not given with explicit names (second exammple) |
NAto0 |
(logical) optional replacemet of |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
Note : The arguments 'namePrefix', 'NAto0', 'callFrom' and 'silent' must be given with full name to be recognized as such (and not get considered as vector for merging).
Value
This function returns a matrix of merged values
See Also
merge (for two data.frames)
Examples
x1 <- c(a=1, b=11, c=21)
x2 <- c(b=12, c=22, a=2)
x3 <- c(a=3, d=43)
mergeVectors(vect1=x1, vect2=x2, vect3=x3)
x4 <- 41:44 # no names - not conform for merging
mergeVectors(x1, x2, x3, x4)
Extended version of merge for multiple objects (even without rownames)
Description
mergeW2 povides flexible merging out of 'MArrayLM'-object (if found, won't consider any other input-data) or of separate vectors or matrixes.
The main idea was to have somthing not adding add'l lines as merge might do, but to stay within the frame of the 1st argument given, even when IDs are repeated,
so the output follows the order of the 1st argument, non-redundant IDs are created (orig IDs as new column).
If no 'MArrayLM'-object found: try to combine all elements of input '...', input-names must match predefined variants 'chInp'.
IDs given in 1st argument and not found in later arguments will be displayed as NA in the output matrix of data.frame.
Note : (non-data) arguments must be given with full name (so far no lazy evaluation, may conflict with names in 'inputNamesLst').
Note : special characters in colnames bound to give trouble.
Note : when no names given, mergeW2 will presume order of elements (names) from 'inputNamesLst'.
PROBLEM : error after xxMerg3 when several entries have matching (row)names but some entries match only partially (what to do : replace with NAs ??)
Usage
mergeW2(
...,
nonRedundID = TRUE,
convertDF = TRUE,
selMerg = TRUE,
inputNamesLst = NULL,
noMatchPursue = TRUE,
standColNa = FALSE,
lastOfMultCols = c("p.value", "Lfdr"),
duplTxtSep = "_",
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
... |
all data (vectors, matrixes or data.frames) intendes for merge |
nonRedundID |
(logical) if TRUE, allways add 1st column with non-redundant IDs (add anyway if non-redundant IDs found ) |
convertDF |
(logical) allows converting output in data.frame, add new heading col with non-red rownames & check which cols should be numeric |
selMerg |
(logical) if FALSE toggle to classic merge() (will give more rows in output in case of redundant names |
inputNamesLst |
(list) named list with character vectors (should be unique), search these names in input for extracting/merging elements use for 'lazy matching' when checking names of input, default : 7 groups ('Mvalue', 'Avalue','p.value','mouseInfo','Lfdr','link','filt') with common short versions |
noMatchPursue |
(logical) allows using entries where 0 names match (just as if no names given) |
standColNa |
(logical) if TRUE return standard colnames as defined in 'inputNamesLst' (ie 'chInp'), otherwise colnames as initially provided |
lastOfMultCols |
may specify input groups where only last col will be used/extracted |
duplTxtSep |
(character) separator for counting/denomiating multiple occurances of same name |
silent |
(logical) suppress messages |
debug |
(logical) for bug-tracking: more/enhanced messages and intermediate objects written in global name-space |
callFrom |
(character) allows easier tracking of message(s) produced |
Value
matrix or data.frame of fused data
See Also
Examples
t1 <- 1:10; names(t1) <- letters[c(1:7,3:4,8)]
t2 <- 20:11; names(t2) <- letters[c(1:7,3:4,8)]
t3 <- 101:110; names(t3) <- letters[c(11:20)]
t4 <- matrix(100:81,ncol=2,dimnames=list(letters[1:10],c("co1","co2")))
t5 <- cbind(t1=t1,t52=t1+20,t53=t1+30)
t1; t2; t3; cbind(t1,t2)
mergeW2(Mval=t1,p.value=t2,debug=FALSE)
Minimum distance/difference between values
Description
This function aims to find the min distance (ie closest point) to any other x (numeric value), ie intra 'x' and returns matrix with 'index','value','dif','ppm','ncur','nbest','best'. At equal distance to lower & upper neighbour point, the upper (following) point is chosen (as single best). In case of multiple ex-aequo distance returns 1st of multiple, may be different at various repeats.
Usage
minDiff(
x,
digSig = 3,
ppm = TRUE,
initOrder = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
(numeric) vector to search minimum difference |
digSig |
number of significant digits, used for ratio or ppm column |
ppm |
(logical) display distance as ppm (1e6*diff/refValue, ie normalized difference eg as used in mass spectrometry), otherwise the ratio is given as : value(from 'x') / closestValue (from 'x') |
initOrder |
(logical) return matrix so that 'x' matches exactely 2nd col of output |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a matrix
See Also
Examples
set.seed(2017); aa <- 100*c(0.1 +round(runif(20),2),0.53,0.53)
minDiff(aa);
minDiff(aa,initO=TRUE,ppm=FALSE); .minDif(unique(aa))
Moderated Pairwise t-test From Limma
Description
This function runs moderated t-test from package limma on each line of data.
Note: This function requires the package limma from bioconductor being installed.
The limma contrast-matrix has to be read by column, the lines in the contrast-matrix containing '+1' will be compared to the '-1' lines, eg grpA-grpB .
Local false discovery rates (lfdr) estimations will be made using the CRAN-package fdrtool (if available).
Usage
moderTest2grp(
dat,
grp,
limmaOutput = TRUE,
addResults = c("lfdr", "FDR", "Mval", "means"),
testOrientation = "=",
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat |
matrix or data.frame with rows for multiple (independent) tests, use ONLY with 2 groups; assumed as log2-data |
grp |
(factor) describes column-relationship of 'dat' (1st factor is considered as reference -> orientation of M-values !!) |
limmaOutput |
(logical) return full (or extended) MArrayLM-object from limma or 'FALSE' for only the (uncorrected) p.values |
addResults |
(character) types of results to add besides basic limma-output, data are assumed to be log2 ! (eg "lfdr" using fdrtool-package, "FDR" or "BH" for BH-FDR, "BY" for BY-FDR, "bonferroni" for Bonferroni-correction, "qValue" for lfdr by qvalue, "Mval", "means" or "nonMod" for non-moderated test and he equivaent all (other) multiple testing corrections chosen here) |
testOrientation |
(character) for one-sided test (">","greater" or "<","less"), NOTE : 2nd grp is considered control/reference, '<' will identify grp1 < grp2 |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a limma-type object of class MArrayLM (which can be handeled like a list)
See Also
lmFit and the eBayes-family of functions in package limma, p.adjust
Examples
set.seed(2017); t8 <- matrix(round(rnorm(1520,10,0.4),2), ncol=8,
dimnames=list(paste("l",1:190),c("AA1","BB1","CC1","DD1","AA2","BB2","CC2","DD2")))
t8[3:6,1:2] <- t8[3:6,1:2] +3 # augment lines 3:6 for AA1&BB1
t8[5:8,5:6] <- t8[5:8,5:6] +3 # augment lines 5:8 for AA2&BB2 (c,d,g,h should be found)
t4 <- log2(t8[,1:4]/t8[,5:8])
## Two-sided testing
fit4 <- moderTest2grp(t4,gl(2,2))
# If you have limma installed we can now see further
if(requireNamespace("limma")) {
limma::topTable(fit4, coef=1, n=5)} # effect for 3,4,7,8
## One-sided testing
fit4in <- moderTest2grp(t4,gl(2,2), testO="<")
# If you have limma installed we can now see further
if(requireNamespace("limma")) {
limma::topTable(fit4in, coef=1, n=5) }
Multiple Moderated Pairwise t-tests From Limma
Description
This function runs (selected or all) pairwise combinations of moderated t-tests from package 'limma' on each line of data against. Note: This function requires the package limma from bioconductor. The limma contrast-matrix has to be read by column, the lines in the contrast-matrix containing '+1' will be compared to the '-1' lines, eg grpA-grpB .
Usage
moderTestXgrp(
dat,
grp,
useComparison = NULL,
limmaOutput = TRUE,
addResults = c("lfdr", "FDR", "Mval", "means"),
testOrientation = "=",
sep = NULL,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat |
matrix or data.frame with rows for multiple (independent) tests, use ONLY with 2 groups; assumed as log2-data !!! |
grp |
(factor) describes column-relationship of 'dat' (1st factor is considered as reference -> orientation of M-values !!) |
useComparison |
(numeric, character or matrix) optional way to indicate which pairwise comparisons should be performed :
if |
limmaOutput |
(logical) return full (or extended) MArrayLM-object from limma or 'FAlSE' for only the (uncorrected) p.values |
addResults |
(character) types of results to add besides basic limma-output, data are assumed to be log2 ! (eg "lfdr" using fdrtool-package, "FDR" or "BH" for BH-FDR, "BY" for BY-FDR, "bonferroni" for Bonferroni-correction, "qValue" for lfdr by qvalue, "Mval", "means" or "nonMod" for non-moderated test and he equivaent all (other) multiple testing corrections chosen here) |
testOrientation |
(character) for one-sided test (">","greater" or "<","less"), NOTE : 2nd grp is considered control/reference, '<' will identify grp1 < grp2 |
sep |
(character) optional custom choice for separator for column-names of pairwise comparisons (if |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
When multiple pairwise comparisons will be run, first a global linear model will be estimated and the particular pairwise comparisons will then be performed using a contrast-matrix. This process is described with the bioconductor package limma which is used underneith.
By default (useComparison=NULL), the first of all possible pairwise comparisons will be run.
If you would like to run all comparisons, plase set useComparison="all".
Besides, it is also possible to custom choose which comparisons should be run (and which order of sample/reference) via the argument useComparison using
the character vector '–' as separator for the two groups of samples (referring to argument grp) to be compared.
This will be interpreted as 'sample–reference' (additional space around the separator, if present, will be removed), thus the second element will be used as reference.
Furthermore, the argument useComparison may be a matrix of 2 columns (for sample and reference) where each line represents a pairwise comparison that should be run.
As effort for compatibility to previous versions and compatibility to standard writing in limma the group-separator '-' in useComparison has limited support :
This (single character) separator will be internally converted to '–' and in absence of '-' in argument grp, output will have the initial (single character) separator '-'.
Concerning the separator used when reporting results for pairwise comparisons :
If argument grp contains any '-', comparisons of groups will always (!) get reported using '–' as separator to avoid any confusion.
In case useComparison is a matrix, the reported comparisons will have '-' if grp does not contain as well any '-', otherwise '–' will be used
(to support compatibility with results from limma).
Please note, that in the output of this function the Benjamini-Hochberg (BH) adjusted p-values are called 'FDR' (see argument addResults).
the output caontains a list-element named setup summarizing the global setup as captured (names of groups of samples), including the names of the pairwise combinations that were tested.
Value
This function returns a limma-type MA-object (which can be handeled like a list), or when problems are encountered NULL
See Also
lmFit and the eBayes-family of functions in package limma;
getPWseparator and convPairwiseSetup for orgnizing experimental setup; moderTest2grp for simplified single comparisons (with much fewer options/flexibility)
Examples
grp3 <- factor(rep(LETTERS[c(3,1,4)],c(2,3,3)))
set.seed(2017); t8 <- matrix(round(rnorm(208*8,10,0.4),2), ncol=8,
dimnames=list(paste(letters[],rep(1:8,each=26),sep=""), paste0(grp3, c(1:2,1:3,1:3))))
t8[3:6,1:2] <- t8[3:6,1:2] +3 # augment lines 3:6 (c-f)
t8[5:8,c(1:2,6:8)] <- t8[5:8,c(1:2,6:8)] -1.5 # lower lines
t8[6:7,3:5] <- t8[6:7,3:5] +2.2 # augment lines
## expect to find C/A in c,d,g, (h)
## expect to find C/D in c,d,e,f
## expect to find A/D in f,g,(h)
test8 <- moderTestXgrp(t8, grp3)
## Custom choice of what to compare
test8b <- moderTestXgrp(t8, grp3, useComparison=c("D-A","C-A"))
head(test8b$FDR)
head(test8b$Mval)
## Custom choice as matrix
comp4 <- matrix(LETTERS[c(4,3,3,1)], ncol=2)
test4 <- moderTestXgrp(t8, grp3, useComparison=comp4)
## Names of pairwise comparisons performed
test4$setup$concat
## One can also use functions from package limma to see more
library(limma)
topTable(test8b, n=5)
Multiple replacement of entire character elements in simple vector, matrix or data.frame
Description
This functions allows multiple types of replacements of entire character elements in simple vector, matrix or data.frame. In addtion, the result may be optionally directly transformed to logical or numeric
Usage
multiCharReplace(
mat,
repl,
convTo = NULL,
silent = FALSE,
debug = TRUE,
callFrom = NULL
)
Arguments
mat |
(character vector, matrix or data.frame) main data |
repl |
(matrix or list) tells what to replace by what: If matrix the 1st oolumn will be considered as 'old' and the 2nd as 'replaceBy'; if named list, the names of the list-elements will be consdered as 'replaceBy' |
convTo |
(character) optional conversion of content to 'numeric' or 'logical' |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns an object of same dimension as input (with replaced content)
See Also
Examples
x1 <- c("ab","bc","cd","efg","ghj")
multiCharReplace(x1, cbind(old=c("bc","efg"), new=c("BBCC","EF")))
x2 <- c("High","n/a","High","High","Low")
multiCharReplace(x2, cbind(old=c("n/a","Low","High"), new=c(NA,FALSE,TRUE)),convTo="logical")
# works also to replace numeric content :
x3 <- matrix(11:16, ncol=2)
multiCharReplace(x3, cbind(12:13,112:113))
Simple Multi-to-Multi Matching of (Concatenated) Terms
Description
This function allows convenient matching of multi-to-multi relationships between two objects/vectors.
It was designed for finding common elements in multiple to multiple matching situations (eg when comparing c("aa; bb", "cc") to c("bb; ab","dd"),
ie to find 'bb' as matching between both objects).
Usage
multiMatch(
x,
y,
sep = "; ",
sep2 = NULL,
method = "byX",
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
(vector or list) first object to compare; if vector, the (partially) concatenated identifyers (will be split using separator |
y |
(vector or list) second object to compare; if vector, the (partially) concatenated identifyers (will be split using separator |
sep |
(character, length=1) separator used to split concatenated identifyers (if |
sep2 |
(character, length=1) optional separator used when |
method |
(character) mode of operation: 'asIndex' to return index of y (those hwo have matches) with names of x (which x are the correpsonding match) |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of message(s) produced |
Details
method='byX' .. returns data.frame with view oriented towards entries of x: character column x for entire content of x; integer column x.Ind for index of x;
character column TagBest for most frequent matching isolated tag/ID; integer column y.IndBest index of most frequent matching y;
character column y.IndAll index for all y matching any of the tags;
character column y.Match for entire content of best matching y;
character column y.Adj for y adjusted to best matching y for easier subsequent perfect matching.
method=c("byX","filter") .. combinded argument to keep only lines with any matches
method='byTag' .. returns matrix (of integers) from view of isolated tags from x (a separate line for each tag from x matching to y);
method=c("byTag","filter") ..if combined as arguments, this will return a data.frame for all unique tags with any matches between x and y, with
additional colunms x.AllInd for all matching x-indexes, y.IndBest best matching y index; x.n for number of different x conatining this tag;
y.AllInd for all matching y-indexes
method='adjustXtoY' .. returns vector with x adjusted to y, ie those elements of x matching are replace by the exact corresponding term of y.
method=NULL .. If no term matching the options shown above is given, another version of 'asIndex' is returned, but indexes to y _after_ spliting by sep.
Again, this method can be filtered by using method="filter" to focus on the best matches to x.
Value
matrix, data.frame or list with matching results depending on method chosen
See Also
Examples
aa <- c("m","k", "j; aa", "m; aa; bb; o; ee", "n; dd; cc", "aa", "cc")
bb <- c("dd; r", "aa", "ee; bb; q; cc", "p; cc")
(match1 <- multiMatch(aa, bb, method=NULL)) # match bb to aa
(match2 <- multiMatch(aa, bb, method="byX")) # match bb to aa
(match3 <- multiMatch(aa, bb, method="byTag")) # match bb to aa
(match4 <- multiMatch(aa, bb, method=c("byTag","filter"))) # match bb to aa
Number Of Fragments After Cut At Specific Character(s) Within Size-range
Description
This function determines number of fragments /entry within range of 'sizeRa' (numeric,length=2) when cutting after 'cutAt'
Usage
nFragments(
protSeq,
cutAt,
sizeRa,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
protSeq |
(character) text to be cut |
cutAt |
(character) position to cut |
sizeRa |
(numeric,length=2) min and max size to consider |
silent |
(logical) suppress messages if |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Value
This function returns a numeric vector with number of fragments for each entry 'protSeq' (names are 'protSeq')
See Also
cutAtMultSites, simple version {nFragments0} (no size-range)
Examples
tmp <- "MSVSREDSCELDLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSKHGGNYLLFNLSERRPDITKLHAKVLEFGWPDLHTPALEKI"
nFragments(c(tmp,"ojioRij"),c("R","K"),c(4,31))
Number Of Fragments After Cut At Specific Character(s)
Description
This function tells the number of fragments/entry when cutting after 'cutAt'
Usage
nFragments0(protSeq, cutAt, silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
protSeq |
(character) text to be cut |
cutAt |
(integer) position to cut |
silent |
(logical) suppress messages if |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Value
This function returns a numeric vector with number of fragments for each entry 'protSeq' (names are 'protSeq')
See Also
more elaborate {nFragments}; cutAtMultSites
Examples
tmp <- "MSVSRTMEDSCELDLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSKHGGNYLLFNLSERRPDITKLHAKVLEFGWPDLHTPALEKI"
nFragments0(c(tmp,"ojioRij"),c("R","K"))
Count number of non-numeric characters
Description
nNonNumChar counts number of non-numeric characters.
Made for positive non-scientific values (eg won't count neg-sign, neither Euro comma ',')
Usage
nNonNumChar(txt)
Arguments
txt |
character vector to be treated |
Value
This function returns a numeric vector with numer of non-numeric characters (ie not '.' or 0-9))
See Also
Examples
nNonNumChar("a1b "); sapply(c("aa","12ab","a1b2","12","0.5"), nNonNumChar)
Fast na.omit
Description
This function removes NAs from input vector, in contrast to na.omit this function has no slot for removed elements.
Usage
naOmit(x, silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
x |
(vector or matrix) data to check & remove |
silent |
(logical) suppress messages if |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Details
Resulting objects from naOmit are smaller in size and subsequent code execution (on large vectors) may be faster (in particular if many NAs get encountered).
Note : This function behaves differently to na.omit with input other than plain vectors. Will not work with data.frames !
Value
This function returns a vector without NAs (matrix input will be transformed to vector). Returns NULL if input consists only of NAs.
See Also
na.fail, na.omit
Examples
aA <- c(11:13,NA,10,NA);
naOmit(aA)
Transform matrix to non-ambiguous matrix (in respect to given column)
Description
nonAmbiguousMat makes values of matrix 'mat' in col 'byCol' unique.
Usage
nonAmbiguousMat(
mat,
byCol,
uniqOnly = FALSE,
asList = FALSE,
nameMod = "amb_",
silent = TRUE,
debug = FALSE,
callFrom = NULL
)
Arguments
mat |
numeric or character matrix (or data.frame), column specified by 'byCol' must be/will be used as.numeric, 1st column of 'mat' will be considered like index & used for adding prefix 'nameMod' (unless byCol=1, then 2nd col will be used) |
byCol |
(character or integer-index) column by which ambiguousity will be tested |
uniqOnly |
(logical) if =TRUE return unique only, if =FALSE return unique and single representative of non-unique values (with ” added to name), selection of representative of repeated: first (of sorted) or middle if >2 instances |
asList |
(logical) return result as list |
nameMod |
(character) prefix added to 1st column of 'mat' (expect 'by') for indicating non-unique/ambiguous values |
silent |
(logical) suppress messages |
debug |
(logical) for bug-tracking: more/enhanced messages and intermediate objects written in global name-space |
callFrom |
(character) allows easier tracking of message(s) produced |
Value
sorted non-ambigous numeric vector (or list if 'asList'=TRUE and 'uniqOnly'=FALSE)
See Also
for non-numeric use firstOfRepeated - but 1000x much slower !; get1stOfRepeatedByCol
Examples
set.seed(2017); mat2 <- matrix(c(1:100,round(rnorm(200),2)),ncol=3,
dimnames=list(1:100,LETTERS[1:3]));
head(mat2U <- nonAmbiguousMat(mat2,by="B",na="_",uniqO=FALSE),n=15)
head(get1stOfRepeatedByCol(mat2,sortB="B",sortS="B"))
Make numeric vector non-ambiguous (ie unique)
Description
Thios function transfomrmes a vector of (named) numeric values x into unique.
Note: for non-numeric use the function firstOfRepeated - but 1000x slower !
Return sorted non-ambigous numeric vector (or list if 'asList'=TRUE and 'uniqOnly'=FASLSE)
Usage
nonAmbiguousNum(
x,
uniqOnly = FALSE,
asList = FALSE,
nameMod = "amb_",
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
(numeric) main input |
uniqOnly |
(logical) if=TRUE return unique only, if =FALSE return unique and single representative of non-unique values (with ” added to name), selection of representative of repeated: first (of sorted) or middle if >2 instances |
asList |
(logical) return list |
nameMod |
(character) text to add in case on ambiguous values, default="amb_" |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Value
sorted non-ambigous numeric vector (or list if 'asList'=TRUE and 'uniqOnly'=FALSE)
See Also
firstOfRepeated for non-numeric use (much slower !!!), duplicated
Examples
set.seed(2017); aa <- round(rnorm(100),2); names(aa) <- 1:length(aa)
str(nonAmbiguousNum(aa))
str(nonAmbiguousNum(aa,uniq=FALSE,asLi=TRUE))
Non-Redundant Lines Of Matrix
Description
This function reduces complexity of matrix (or data.frame) if multiple consectuive (!) lines with same values. Return matrix (or data.frame) without repeated lines (keep 1st occurance)
Usage
nonRedundLines(dat, silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
dat |
(matrix or data.frame) main input |
silent |
(logical) suppress messages if |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Value
This function returns a matrix (or data.frame) without repeated lines (keep 1st occurance)..
See Also
firstLineOfDat, firstOfRepLines, findRepeated, firstOfRepeated, get1stOfRepeatedByCol, combineRedBasedOnCol, correctToUnique
Examples
mat2 <- matrix(rep(c(1,1:3,3,1),2),ncol=2,dimnames=list(letters[1:6],LETTERS[1:2]))
nonRedundLines(mat2)
Filter for unique elements
Description
nonredDataFrame filters 'x' (list of char-vectors or char-vector) for elements unique (to 'ref' or if NULL to all 'x') and of character length.
May be used for different 'accession' for same pep sequence (same 'peptide_id').
Note : made for treating data.frames, may be slightly slower than matrix equivalent
Usage
nonredDataFrame(
dataFr,
useCol = c(pepID = "peptide_id", protID = "accession", seq = "sequence", mod =
"modifications"),
sepCollapse = "//",
callFrom = NULL
)
Arguments
dataFr |
(data.frame) main inpput |
useCol |
(character,length=2) comlumn names of 'dataFr' to use : 1st value designates where redundant values should be gathered; 2nd value designes column of which information should be concatenated |
sepCollapse |
(character) conatenation symbol |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a data.frame of filtered (fewer lines) with additional 2 columns 'nSamePep' (number of redundant entries) and 'concID' (concatenated content)
See Also
combineRedBasedOnCol, correctToUnique, unique
Examples
df1 <- data.frame(cbind(xA=letters[1:5], xB=c("h","h","f","e","f"), xC=LETTERS[1:5]))
nonredDataFrame(df1, useCol=c("xB","xC"))
Normalize Data In Various Modes
Description
Generic normalization of 'dat' (by columns), multiple methods may be applied. The choice of normalization procedures must be done with care, plotting the data before and after normalization may be critical to understandig the initial data structure and the effect of the procedure applied. Inappropriate methods chosen may render interpretation of (further) results incorrect.
Usage
normalizeThis(
dat,
method = c("mean", "average", "median", "trimMean", "rowNormalize", "standardize",
"slope", "twoPointSlope", "exponent", "vsn", "none", "NULL"),
refLines = NULL,
refGrp = NULL,
mode = c("proportional", "additive", "linear", "lin", "logarithmic", "log"),
trimFa = NULL,
minQuant = NULL,
sparseLim = 0.4,
nCombin = 3,
omitNonAlignable = FALSE,
maxFact = 10,
quantFa = NULL,
expFa = NULL,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat |
matrix or data.frame of data to get normalized |
method |
(character) may be "mean","median","NULL","none", "trimMean", "rowNormalize", "slope", "exponent", "twoPointSlope", "vsn"; When |
refLines |
(NULL or numeric) allows to consider only specific lines of 'dat' when determining normalization factors (all data will be normalized) |
refGrp |
Only the columns indicated will be used as reference, default all columns (integer or colnames) |
mode |
(character) may be "proportional", "additive" (for log2 data);
decide if normalization factors will be applied as multiplicative (proportional) or additive; for log2-omics data |
trimFa |
(numeric, length=1) additional parameters for trimmed mean |
minQuant |
(numeric) only used with |
sparseLim |
(integer) only used with |
nCombin |
(NULL or integer) only used with |
omitNonAlignable |
(logical) only used with |
maxFact |
(numeric, length=2) only used with |
quantFa |
(numeric, length=2) additional parameters for quantiles to use with method='slope' |
expFa |
(numeric, length=1) additional parameters for method='exponent' |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Details
In most cases of treating 'Omics'-data one works with the hypothesis that there are no global changes in the structure of all data/columns
Under this htpothesis it is very common to assume the the median (via the argument method) of all samples (ie columns) should remain constant.
For examples samples/columns with less signal will be considered as having received 'accidentally' less material (eg due to the imprecision when transfering very small amounts of liquid samples).
In consequence, a sample having received only 95
Thus, all measures will be multiplied by 1/0.95 (apr 1.053) to compensate for supposed lack of staring material.
LOG-SCALE : With the analysis of 'Omics'-data it is very common to work with data on log-scale.
In this case the argument mode should be set to additive (or log or logarithmic).
At normalization a constant factor will be added (or subtracted) using this mode. This corresponds to a multiplicative factor on regular scale.
Please note that (at this point) the methods 'slope', 'exponent', 'twoPointSlope' and 'vsn' don't distinguish between additive and proportional modes, but take take the data 'as is'
(you may look at the original documenation for more details, see exponNormalize, scaleXY or adjBy2ptReg, justvsn).
Normalization using method="rowNormalize" runs rowNormalize from this package.
In this case, the working hypothesis is, that all values in each row are expected to be the same.
This method could be applied when all series of values (ie columns) are replicate measurements of the same sample.
THere is also an option for treating sparse data (see argument sparseLim), which may, hovere, consume much more comptational ressources,
in particular, when the value nCombin is low (compared to the number of samples/columns).
Normalization using method="standardize" runs scale resulting in a matrix where column-means are set to 0 (or very close to 0)
and sd et 1, standardization by columns. With this method additive or proportional mode give the same output.
Results from this methid should be interpreted with caution, since the absolute values are not any more considered.
Therefor this approach is rather oriented for comparing profiles (no matter how important changes are on an absolute scale)
Normalization using method="vsn" runs justvsn from vsn
(this requires a minimum of 42 rows of input-data and having the Bioconductor package vsn installed).
Note : Depending on the procedure chosen, the normalized data may appear on a different scale.
Value
This function returns a matrix of normalized data (same dimensions as input)
See Also
rowNormalize, exponNormalize, scaleXY, adjBy2ptReg, justvsn
Examples
set.seed(2015); rand1 <- round(runif(300)+rnorm(300,0,2),3)
dat1 <- cbind(ser1=round(100:1+rand1[1:100]), ser2=round(1.2*(100:1+rand1[101:200])-2),
ser3=round((100:1 +rand1[201:300])^1.2-3))
dat1 <- cbind(dat1, ser4=round(dat1[,1]^seq(2,5,length.out=100)+rand1[11:110],1))
dat1[dat1 <1] <- NA
summary(dat1)
dat1[c(1:5,50:54,95:100),]
no1 <- normalizeThis(dat1, refGrp=1:3, meth="mean")
no2 <- normalizeThis(dat1, refGrp=1:3, meth="trimMean", trim=0.4)
no3 <- normalizeThis(dat1, refGrp=1:3, meth="median")
no4 <- normalizeThis(dat1, refGrp=1:3, meth="slope", quantFa=c(0.2,0.8))
dat1[c(1:10,91:100),]
cor(dat1[,3],rowMeans(dat1[,1:2],na.rm=TRUE), use="complete.obs") # high
cor(dat1[,4],rowMeans(dat1[,1:2],na.rm=TRUE), use="complete.obs") # bad
cor(dat1[c(1:10,91:100),4],rowMeans(dat1[c(1:10,91:100),1:2],na.rm=TRUE),use="complete.obs")
cor(dat1[,3],rowMeans(dat1[,1:2],na.rm=TRUE)^ (1/seq(2,5,length.out=100)),use="complete.obs")
Extract pair of numeric values from vector or column-names
Description
This function extracts a pair of numeric values out of a vector or colnames (from a matrix).
This is useful when pairwise comparisons are concatenated like '10c-100c', return matrix with 'index'=selComp, log2rat and both numeric.
Additional white space or character text can be removed via the argument stripTxt.
Of course, the separator sep needs to be specified and should not be included to 'stripTxt'.
Usage
numPairDeColNames(
dat,
selComp = NULL,
stripTxt = NULL,
sep = "-",
columLabel = "conc",
sortByAbsRatio = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat |
(matrix or data.frame) main input |
selComp |
(character) the column index selected |
stripTxt |
(character, max length=2) text to ignore, if NULL heading letter and punctuation characters will be removed; default will remove all letters (and following spaces) |
sep |
(character, length=1) separator between pair of numeric values to extract |
columLabel |
(character) column labels in output |
sortByAbsRatio |
(logical) optional sorting of output by (absolute) log-ratios (most extreme ratios on top) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a matrix
See Also
strsplit and help on regex
Examples
## composed column names
mat1 <- matrix(1:8, nrow=2, dimnames=list(NULL, paste0(1:4,"-",6:9)))
numPairDeColNames(mat1)
numPairDeColNames(colnames(mat1))
## works also with simple numeric column names
mat2 <- matrix(1:8, nrow=2, dimnames=list(NULL, paste0("a",6:9)))
numPairDeColNames(mat2)
Order Lines of Matrix According to Reference (Character) Vector
Description
This function orders lines of matrix mat according to a (character) reference vector ref.
To do so, all columns of mat will be considered to use the first column from left with the best (partial) matching results.
This function first looks for unambiguous perfect matches, and if not found successive rounds of more elaborte partial matching will be engaged:
In case of no perfect matches found, grep of ref on all columns of mat and/or grep of all columns of mat on ref (ie 'reverse grep') will be applied (finally a 'two way grep' approach).
Until a perfect match is found each element of ref will be tested on mat and inversely (for each column) each element of mat will be tested on ref.
The approach with the best number of (unique) matches will be chosen. In case of one-to-many matches, it will be tried to use most complete lines (see also last example).
Usage
orderMatrToRef(
mat,
ref,
addRef = TRUE,
listReturn = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
mat |
(matrix, data.frame) main input of which rows should get re-ordered according to a (character) reference vector |
ref |
(character) reference imposing new order |
addRef |
(logical) add |
listReturn |
(logical) allows retrieving more information in form of list |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns, depending on listReturn, either the input-matrix in new order or a list with $mat (the input matrix in new order), $grep (matched matrix) and $col indicating the colum of mat finally used
See Also
for basic ordering see match; checkGrpOrder for testing each line for expected order, checkStrictOrder to check for strict (ascending or descending) order
Examples
mat1 <- matrix(paste0("__",letters[rep(c(1,1,2,2,3),3) +rep(0:2,each=5)], rep(1:5)), ncol=3)
orderMatrToRef(mat1, paste0(letters[c(3,4,5,3,4)],c(1,3,5,2,4)))
mat2 <- matrix(paste0("__",letters[rep(c(1,1,2,2,3),3) +rep(0:2,each=5)],
c(rep(1:5,2),1,1,3:5 )), ncol=3)
orderMatrToRef(mat2, paste0(letters[c(3,4,5,3,4)],c(1,3,5,1,4)))
mat3 <- matrix(paste0(letters[rep(c(1,1,2,2,3),3) +rep(0:2,each=5)],
c(rep(1:5,2),1,1,3,3,5 )), ncol=3)
orderMatrToRef(mat3, paste0("__",letters[c(3,4,5,3,4)],c(1,3,5,1,3)))
(re)organize data of (3-dim) array as list of replicates
Description
Organize array of all data ('arrIn', long table) into list of (replicate-)arrays (of similar type/layout) based on dimension number 'byDim' of 'arrIn' (eg 2nd or 3rd dim).
Argument inspNChar defines the number of characters to consider, so if the beginning of names is the same they will be separated as list of multiple arrays.
Default will search for '_' separator or trim from end if not found in the relevant dimnames
Usage
organizeAsListOfRepl(
arrIn,
inspNChar = 0,
byDim = 3,
silent = TRUE,
debug = FALSE,
callFrom = NULL
)
Arguments
arrIn |
(array) main input |
inspNChar |
(interger) if inspNChar=0 the array-names (2nd dim of 'arrIn') will be cut before last '_' |
byDim |
(integer, length=1) dimension number along which data will be split in separate elements (considering the first inspNChar characters) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a list of arrays (typically 1st and 2nd dim for specific genes/objects, 3rd for different measures associated with)
See Also
Examples
arr1 <- array(1:24,dim=c(4,3,2),dimnames=list(c(LETTERS[1:4]),
paste("col",1:3,sep=""), c("ch1","ch2")))
organizeAsListOfRepl(arr1)
Convert p-values to lfdr
Description
This function takes a numeric vector of p-values and returns a vector of lfdr-values (local false discovery) using the package fdrtool. Multiple testing correction should be performed with caution, short series of p-values typically pose problems for transforming to lfdr. The transformation to lfdr values may give warning messages, in this case the resultant lfdr values may be invalid !
Usage
pVal2lfdr(x, silent = TRUE, debug = FALSE, callFrom = NULL)
Arguments
x |
(numeric) vector of p.values |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a (numeric) vector of lfdr values (or NULL if data insufficient to run the function 'fdrtool')
See Also
lfdr from fdrtool, other p-adjustments (multiple test correction, eg FDR) in p.adjust
Examples
## Note that this example is too small for estimating really meaningful fdr values
## In consequence, a warning will be issued.
set.seed(2017); t8 <- matrix(round(rnorm(160,10,0.4),2), ncol=8,
dimnames=list(letters[1:20], c("AA1","BB1","CC1","DD1","AA2","BB2","CC2","DD2")))
t8[3:6,1:2] <- t8[3:6,1:2]+3 # augment lines 3:6 (c-f) for AA1&BB1
t8[5:8,5:6] <- t8[5:8,5:6]+3 # augment lines 5:8 (e-h) for AA2&BB2 (c,d,g,h should be found)
head(pVal2lfdr(apply(t8, 1, function(x) t.test(x[1:4], x[5:8])$p.value)))
Simple Package Download Statistics From CRAN
Description
This function allows accessing the most recent counts of package downloads availabale on http://www.datasciencemeta.com/rpackages, obtaining rank quantiles and to compare (multiple) given packages to the bulk data, optionally a plot can be drawn.
Usage
packageDownloadStat(
queryPackages = c("wrMisc", "wrProteo", "cif", "bcv", "FinCovRegularization"),
countUrl = "http://www.datasciencemeta.com/rpackages",
refQuant = (1:10)/10,
options = c("naOmit", "sort"),
figure = TRUE,
log = "",
silent = FALSE,
callFrom = NULL,
debug = FALSE
)
Arguments
queryPackages |
(character or integer) package names of interest, if |
countUrl |
(character) the url where the dayly counts ara available |
refQuant |
(numeric) add reference quantile values to output matrix |
options |
(character) additional seetings : use 'naOmit' to remove NA-lines from output (package-names not found in 'countUrl'); 'sort' for sorting output by number of downloads |
figure |
(logical) decide of figure should be printed |
log |
(character) set count-axis of figure to linear or log-scale (by setting |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) additional messages for debugging |
Details
Detailed articles on this subject have been published on R-Hub (https://blog.r-hub.io/2020/05/11/packagerank-intro/) and on R-bloggers (https://www.r-bloggers.com/2020/10/a-cran-downloads-experiment/). The task of checking the number of downloads for a given package has also been addressed by several other packages (eg dlstats, cranlogs, adjustedcranlogs).
This function only allows accessing counts as listed on the website of www.datasciencemeta.com which get updated dayly.
Please note, that reading all lines from the website may take a few seconds !!
To get a better understanding of the counts read, reference quantiles for download-counts get added by default (see argument refQuant).
The (optional) figure can be drawn in linear scale (default, with minor zoom to lower number of counts) or in log (necessary for proper display of the entire range of counts), by setting the argument log="y".
The number of downloads counted by RStudio may not be a perfect measure for the actual usage/popularity of a given package, the articles cited above discuss this in more detail. For example, multiple downloads from the same IP or subsequent downloads of multiple (older) versions of the same package seem to get counted, too.
Value
This function retuns a matrix with download counts (or NULL if the web-site can't be accessed or the query-packages are not found there)
See Also
packages cranlogs and packageRank
Examples
## Let's try a microscopic test-file (NOT representative for true up-to-date counts !!)
pack1 <- c("cif", "bcv", "FinCovRegularization", "wrMisc", "wrProteo")
testFi <- file.path(system.file("extdata", package="wrMisc"), "rpackagesMicro.html")
packageDownloadStat(pack1, countUrl=testFi, log="y", figure=FALSE)
## For real online counting simply use the argument countUrl in default setting
Convert Pairs of Node-Names to Non-Oriented Propensity Matrix
Description
Numerous network query tools produce a listing of pairs of nodes (with one pair of nodes per line).
Using this function such a matrix (or data.frame) can be combined to this more comprehensive view as propensity-matrix.
Usage
pairsAsPropensMatr(mat, silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
mat |
(matrix) main input, matrix of interaction partners with each line as a separate pair of nodes; the first two columns should contain identifiers of the nodes |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
Note, this has been primarily developed for undirected interaction networks, the resulting propensity-matrix does not show any orientation any more. In a number of applications (eg in protein-protein interaction networks, PPI) the resulting matrix may be rather sparse.
Value
This function returns matrix or data.frame
See Also
uses typically input from filterNetw
Examples
pairs3L <- matrix(LETTERS[c(1,3,3, 2,2,1)], ncol=2) # loop of 3
(netw13pr <- pairsAsPropensMatr(pairs3L)) # as prop matr
Partial unlist of lists of lists
Description
partUnlist does partial unlist for treating list of lists : New (returned) list has one level less of hierarchy
(Highest level list will be appended). In case of conflicting (non-null) listnames a prefix will be added.
Behaviour different to unlist when unlisting list of matrixes.
Usage
partUnlist(lst, sep = "_", silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
lst |
(list) main input, list to be partially unlisted |
sep |
(character, length=1) separator for names |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a list with partially reduced nested structure
See Also
Examples
partUnlist(list(list(a=11:12,b=21:24), list(c=101:101,d=201:204)))
li4 <- list(c=1:3, M2=matrix(1:4,ncol=2), L3=list(L1=11:12, M3=matrix(21:26,ncol=2)))
partUnlist(li4)
unlist(li4, rec=FALSE)
Partial distance matrix (focus on closest)
Description
partialDist calculates distance matrix like dist for 1- or 2-dim data, but only partially, ie only cases of small distances.
This function was made for treating very large data-sets where only very close distances to a given point need to be found,
it allows to overcome memory-problems with larger data (and faster execution with > 50 rows of 'dat').
Usage
partialDist(
dat,
groups,
overLap = TRUE,
method = "euclidean",
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat |
(matrix of numeric values) main input |
groups |
(factor) to split using |
overLap |
(logical) if TRUE make groups overlapping by 1 value (ie maintain some context-information) |
method |
'character' name of method passed to |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of message(s) produced |
Value
This function returns a matrix with partial distances (not of class 'dist' object)
See Also
Examples
set.seed(2016); mat3 <- matrix(runif(300),nr=30)
round(dist(mat3), 1)
round(partialDist(mat3, gr=3), 1)
Advanced paste-collapse
Description
This function is a variant of paste for convenient use of paste-collapse and separation of last element to paste (via 'lastCol').
This function was mode for more human like enumeriating in output and messages.
If multiple arguments are given without names they will all be concatenated, if they contain names lazy evaluation for names will be tried
(with preference to longest match to argument names).
Note that some special characters (like backslash) may need to be protetected when used with 'collapse' or 'quoteC'.
Returns character vector of length 1 (everything pasted together)
Usage
pasteC(..., collapse = ", ", lastCol = " and ", quoteC = "")
Arguments
... |
(character) main input to be collapsed |
collapse |
(character,length=1) element to use for collapsing |
lastCol |
(character) text to use before last item enumerated element |
quoteC |
character to use for citing with quotations (default "") |
Value
This function returns a character vector of truncated versions of intpup txt
See Also
paste for basic paste
Examples
pasteC(1:4)
Filter Lines Of Matrix For Max Number Of NAs
Description
This function produces a logical matrix to be used as filter for lines of 'dat' for sufficient presence of non-NA values (ie limit number of NAs per line).
Filter abundance/expression data for min number and/or ratio of non-NA values in at east 1 of multiple groups.
This type of procedure is common in proteomics and tanscriptomics, where a NA can many times be assocoaued with quantitation below detetction limit.
Usage
presenceFilt(
dat,
grp,
useComparison = NULL,
maxGrpMiss = 1,
ratMaxNA = 0.8,
minVal = NULL,
sep = NULL,
experSetup = NULL,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat |
matrix or data.frame (abundance or expression-values which may contain some |
grp |
factor of min 2 levels describing which column of 'dat' belongs to which group (levels 1 & 2 will be used) |
useComparison |
(character or matrix) optional argument allowing to specify which pairwise comparions sould be performed, default |
maxGrpMiss |
(numeric) at least 1 group has not more than this number of NAs (otherwise marke line as bad) |
ratMaxNA |
(numeric) at least 1 group below this content of |
minVal |
(default NULL or numeric), any value below will be treated like |
sep |
(character) in case |
experSetup |
(list) optional experimental setup |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a logical matrix (with separate col for each pairwise combination of 'grp' levels) indicating if line of 'dat' acceptable based on NAs (and values minVal)
See Also
presenceGrpFilt, there are also other packages on CRAN and Bioconductor dedicated to filtering
Examples
mat <- matrix(rep(8,150), ncol=15, dimnames=list(NULL,
paste0(rep(LETTERS[4:2],each=6),1:6)[c(1:5,7:16)]))
mat[lower.tri(mat)] <- NA
mat[,15] <- NA
mat[c(2:3,9),14:15] <- NA
mat[c(1,10),13:15] <- NA
mat
# default : at least 1 group with max 1 NA and one group below 80% NA
presenceFilt(mat, substr(colnames(mat),1,1))
# custom 2 groups
presenceFilt(mat, rep(1:2,c(9,6))) # D1- C4, C5 - B4
# one more example
dat1 <- matrix(1:56, ncol=7)
dat1[c(2:6,10,12,18,19,20,22,23,26:28,30,31,34,38,39,50,54)] <- NA
grp3 <- letters[c(3,3,2,2,1,1,1)]
colnames(dat1) <- correctToUnique(grp3, sep="")
dat1
## At least one group wo any NAs
presenceFilt(dat1, grp3, maxGr=0)
presenceFilt(dat1, gr=gl(2,4)[-1], maxGr=1, ratM=0.1)
presenceFilt(dat1, gr=gl(2,4)[-1], maxGr=2, rat=0.5)
Filter For Each Group Of Columns For Sufficient Data As Non-NA
Description
The aim of this function is to filter for each group of columns for sufficient data as non-NA.
Usage
presenceGrpFilt(
dat,
grp,
presThr = 0.75,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat |
matrix or data.frame (abundance or expression-values which may contain some |
grp |
factor of min 2 levels describing which column of 'dat' belongs to which group (levels 1 & 2 will be used) |
presThr |
(numeric) min ratio of non- |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
This function allows to identify lines with an NA-content above the threshold presThr per group as defined by the levels of factor grp.
With different types of projects/questions different threshold presThr levels may be useful.
For example, if one would like to keep the degree of threshold presThrs per group rather low, one could use a value of 0.75 (ie >= 75
Value
logical matrix (with on column for each level of grp)
See Also
presenceFilt, there are also other packages totaly dedicated to filtering on CRAN and Bioconductor
Examples
mat <- matrix(NA, nrow=11, ncol=6)
mat[lower.tri(mat)] <- 1
mat <- cbind(mat, mat[,1:4])
colnames(mat) <- c(paste0("re",1:6), paste0("x",1:4))
mat[6:8,7:10] <- mat[1:3,7:10] # ref
mat[9:11,1:6] <- mat[2:4,1:6]
## accept 1 NA out of 4, 2 NA out of 6 (ie certainly present)
(filt0a <- presenceGrpFilt(mat, rep(1:2, c(6,4)), pres=0.66))
## accept 2 NA out of 4, 2 NA out of 6 (ie min 50% present)
(filt0b <- presenceGrpFilt(mat, rep(1:2, c(6,4)), pres=0.5))
## accept 3 NA out of 4, 4 NA out of 6 (ie possibly present)
(filt0c <- presenceGrpFilt(mat, rep(1:2, c(6,4)), pres=0.19))
Protect Special Characters
Description
Some characters do have a special meaning when used with regular expressions.
This concerns characters like a point, parinthesis, backslash etc.
Thus, when using grep or any related command, shuch special characters must get protected in order to get considered as they are.
Usage
protectSpecChar(
x,
prot = c(".", "\\", "|", "(", ")", "[", "{", "^", "$", "*", "+", "?"),
silent = TRUE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
character vector to be prepared for use in regular expressions |
prot |
(character) collection of characters that need to be protected |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a modified character vector
Examples
aa <- c("abc","abcde","ab.c","ab.c.e","ab*c","ab\\d")
grepl("b.", aa) # all TRUE
grepl("b\\.", aa) # manual prootection
grepl(protectSpecChar("b."), aa)
Suggestions Of Collections Of Classical Separators For Pairwise Combinations
Description
This function provides collecions of typical separators used for combined names in pair-wise testing for later choice of the most suited.
Usage
pwSeparatorList(
type = "split1",
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
type |
(character) allows selecting of different types of collections of separators |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
Depending if one rather looks for separators for cutting existing names of for suggesting separators for fresh concatenation, two differentsets of collections are available via the argument type.
Using type="split" will default to type="split1", similarly type="combine" will be used as type="combine1".
The option type="split1" has a default collection of shorter/compact separators for splitting
The option type="split2" allows more extensive search for 38 separators (ie combinations with ' ','-' and '_'), but extensive checking may cost CPU time.
The option type="split3" has a shorter collection of 12 basic commonly used separators.
The option type="split4" to type="split9" default to 'split1'
The option type="combine1" does not suggest '–' (neither '__') since if '-' may not be chosen ins the first place, using '–' as separator next to '-' occuring inside gourp-names may not enhance visibility.
The option type="combine2" contains a collection of sperators using 'vs' or 'versus'
The option type="combine3" is designed for explicite terms (starts with ' - versus - ', for suggesting compact terms rather use type="combine1"
The option type="combine4" to type="combine9" default to 'combine1'
Value
This function returns a charcter vector with proposed separators for later choosing the most suited
See Also
(for running multiple pair-wise test) moderTestXgrp, convPairwiseSetup, presenceFilt, getPWseparator, indexGroupsFromPW,
(used underneith:) grep, strsplit
Examples
pwSeparatorList(type="split1")
Distance of categorical data (Jaccard, Rand and adjusted Rand index)
Description
randIndFx calculates distance of categorical data (as Rand Index, Adjusted Rand Index or Jaccard Index).
Note: uses/requires package flexclust
Methods so far available (via flexclust): "ARI" .. adjusted Rand Index, "RI" .. Rand index, "J" .. Jaccard, "FM" .. Fowlkes-Mallows.
Usage
randIndFx(
ma,
method = "ARI",
adjSense = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
ma |
(matrix) main input for distance calulation |
method |
(character) name of distance method (eg "ARI","RI","J","FM") |
adjSense |
(logical) allows introducing correlation/anticorrelation (interprete neg distance results as anti) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a distance matrix
See Also
comPart in randIndex
Examples
set.seed(2016); tab2 <- matrix(sample(1:2, size=42, replace=TRUE), ncol=7)
if(requireNamespace("flexclust")) { flexclust::comPart(tab2[1,], tab2[2,])
flexclust::comPart(tab2[1,], tab2[3,])
flexclust::comPart(tab2[1,], tab2[4,]) }
## via randIndFx():
randIndFx(tab2, adjSense=FALSE)
cor(t(tab2))
randIndFx(tab2, adjSense=TRUE)
Contingenty tables for fit of ranking
Description
Count the number of instances where the corresponding columns of 'dat' have a value matching the group number as specified by 'grp'.
Counting will be performed/repeated independently for each line of 'dat'.
Returns array (1st dim is rows of dat, 2nd is unique(grp), 3rd dim is ok/bad), these results may be tested using eg fisher.test.
This function was made for prearing to test the ranking of multiple features (lines in 'mat') including replicates (levels of 'grp').
Usage
rankToContigTab(dat, grp)
Arguments
dat |
(matrix or data.frame of integer values) ranking of multiple features (lines), equal ranks may occur |
grp |
(integer) expected ranking |
Value
array (1st dim is rows of dat, 2nd is unique(grp), 3rd dim is ok/bad)
See Also
Examples
# Let's create a matrix with ranks (equal ranks do occur)
ma0 <- matrix(rep(1:3,each=6), ncol=6, dimnames=list(
c("li1","li2","ref"), letters[1:6]))
ma0[1,6] <- 1 # create item not matching correctly
ma0[2,] <- c(3:1,2,1,3) # create items not matching correctly
gr0 <- gl(3,2) # the expected ranking (as duplicates)
(count0 <- rankToContigTab(ma0,gr0))
cTab <- t(apply(count0, c(1,3) ,sum))
# Now we can compare the ranking of line1 to ref ...
fisher.test(cTab[,c(3,1)]) # test li1 against ref
fisher.test(cTab[,c(3,2)]) # test li2 against ref
Calculate all ratios between x and y
Description
This function calculates all possible pairwise ratios between all individual calues of x and y, or samples up to a maximum number of combinations.
Usage
ratioAllComb(
x,
y,
maxLim = 10000,
isLog = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
(numeric) vector, numerator for constructing rations |
y |
(numeric) vector, denominator for constructing rations |
maxLim |
(integer) allows reducing complexity by drawing for very long x or y |
isLog |
(logical) adjust ratio calculation to log-data |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Examples
set.seed(2014); ra1 <- c(rnorm(9,2,1),runif(8,1,2))
ratioAllComb(ra1[1:9],ra1[10:17])
boxplot(list(norm=ra1[1:9], unif=ra1[10:17], rat=ratioAllComb(ra1[1:9],ra1[10:17])))
Convert ratio to ppm
Description
This function transforms ratio 'x' to ppm (parts per million). If 'y' not given (or different length as 'x'), then 'x' is assumed as ratio otherise rations are constructed as x/y is used lateron. Does additional checking : negative values not expected - will be made absolute !
Usage
ratioToPpm(
x,
y = NULL,
nSign = NULL,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
(numeric) main input |
y |
(numeric) optional value to construct ratios (x/y). If NULL (or different length as 'x'), then 'x' will be considered as ratio. |
nSign |
(numeric) number of significan digits |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a numeric vector of ppm values
See Also
XYToDiffPpm for ppm of difference as used in mass spectrometrie
Examples
set.seed(2017); aa <- c(1.000001,0.999999,1+rnorm(10,0,0.001))
cbind(x=aa,ppm=ratioToPpm(aa,nSign=4))
Read batch of csv-files
Description
This function was designed to read screening data split in parts (with common structure) and saved to multiple files,
to extract the numeric columns and to compile all (numeric) data to a single array (or list). Some screening platforms save results while progressing
through a pile of microtiter-plates separately. The organization of the resultant files is structured through file-names and all files have exactely the same organization of lines and columns/
European or US-formatted csv files can be read, if argument fileFormat is NULL both types will be tested, otherwise it allows to specify a given format.
The presence of headers (to be used as column-names) may be tested using checkFormat.
Usage
readCsvBatch(
fileNames = NULL,
path = ".",
fileFormat = "Eur",
checkFormat = TRUE,
returnArray = TRUE,
columns = c("Plate", "Well", "StainA"),
excludeFiles = "All infected plates",
simpleNames = TRUE,
minNamesLe = 4,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
fileNames |
(character) names of files to be read, if |
path |
(character) where files should be read (folders should be written in R-style) |
fileFormat |
(character) may be |
checkFormat |
(logical) if |
returnArray |
(logical) allows switching from array to list-output |
columns |
(NULL or character) column-headers to be extracted (if specified), 2nd value may be comlumn with rownames (if rownames are encountered as increasing rownames) |
excludeFiles |
(character) names of files to exclude (only used when reading all files of given directory) |
simpleNames |
(logical) allows truncating names (from beginning) to get to variable part (using .trimLeft()), but keeping 'minNamesLe' |
minNamesLe |
(interger) min length of column-names if simpleNames=TRUE |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Value
This function returns an array (or list if returnArray=FALSE) of all numeric data read (numerical columns only) from individual files
See Also
read.table, writeCsv, readXlsxBatch
Examples
path1 <- system.file("extdata", package="wrMisc")
fiNa <- c("pl01_1.csv","pl01_2.csv","pl02_1.csv","pl02_2.csv")
datAll <- readCsvBatch(fiNa, path1)
str(datAll)
## batch reading of all csv files in specified path :
datAll2 <- readCsvBatch(fileNames=NULL, path=path1, silent=TRUE)
Batch Reading Of Tabulated Text-Files
Description
This function allows batch reading of multiple tabulated text files n batch.
The files can be designed specifically, or, alternatively all files from a given directory can be read.
If package data.table is available, faster reading of files will be performed using the function fread.
Usage
readTabulatedBatch(
query,
path = NULL,
dec = ".",
header = "auto",
strip.white = FALSE,
blank.lines.skip = TRUE,
fill = FALSE,
filtCol = 2,
filterAsInf = TRUE,
filtVal = 5000,
silent = FALSE,
callFrom = NULL,
debug = FALSE
)
Arguments
query |
(character) vector of file-names to be read, if |
path |
(character) path for reading files, if |
dec |
(character, length=1) decimals to use, will be passed to |
header |
(character, length=1) path for reading files, if |
strip.white |
(logical, length=1) Strips leading and trailing whitespaces of unquoted fields, will be passed to |
blank.lines.skip |
(logical, length=1) If |
fill |
(logical, length=1) If |
filtCol |
(integer, length=1) which columns should be used for filtering, if |
filterAsInf |
(logical, length=1) filter as inferior or equal ( |
filtVal |
(numeric, length=1) which numeric threshold should be used for filtering, if |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) display additional messages for debugging |
Details
If you want to provide a flexible pattern of ffile-names, this has to be done before calling this usntion, eg using grep to provide an explicit collection of flles.
However, it is possible to read different files from different locations/directories, the length of path must match the length of query
Value
This function returns a list of data.frames
See Also
fread, read.delim, for reading batch of csv files : readCsvBatch
Examples
path1 <- system.file("extdata", package="wrMisc")
fiNa <- c("a1.txt","a2.txt")
allTxt <- readTabulatedBatch(fiNa, path1)
str(allTxt)
Read Tabular Content Of Files With Variable Number Of Columns
Description
Reading the content of files where the number of separators (eg tabulation) is variable poses problems with traditional methods for reding files, like read.table.
This function reads each line independently and then parses all separators therein. The first line is assumed to be column-headers.
Finally, all data will be returned in a matrix adopted to the line with most separators and if the number of column-headers is insufficient, new (unique) column-headers will be generated.
Thus, the lines may contain different number of elements, empty elements (ie tabular fields) will always get added to right of data read
and their content will be as defined by argument emptyFields (default NA).
Usage
readVarColumns(
fiName,
path = NULL,
sep = "\t",
header = TRUE,
emptyFields = NA,
refCo = NULL,
supNa = NULL,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
fiName |
(character) file-name |
path |
(character) optional path |
sep |
(character) separator (between columns) |
header |
(logical) indicating whether the file contains the names of the variables as its first line. |
emptyFields |
( |
refCo |
(integer) for custom choice of column to be used as row-names (default will use 1st text-column) |
supNa |
(character) base for constructing name for columns wo names (+counter starting at 2), default column-name to left of 1st col wo colname |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
Note, this functions assumes one line of header and at least one line of data ! Note, for numeric data the comma is assumed to be US-Style (as '.'). Note, that it is assumed, that any missing fields for the complete tabular view are missing on the right (ie at the end of line) !
Value
This function returns a matrix (character or numeric)
See Also
for regular 'complete' data read.table and its argument flush
Examples
path1 <- system.file("extdata", package="wrMisc")
fiNa <- "Names1.tsv"
datAll <- readVarColumns(fiName=file.path(path1, fiNa))
str(datAll)
Read Batch of Excel xlsx-Files
Description
readXlsxBatch reads data out of multiple xlsx files, the sheet indicated by 'sheetInd' will be considered.
All files must have the same organization of data, as this is typically the case when high-throughput measurements are automatically saved while experiments progress.
In particular, the first file read is used to structure the output.
Usage
readXlsxBatch(
fileNames = NULL,
path = ".",
fileExtension = "xlsx",
excludeFiles = NULL,
sheetInd = 1,
checkFormat = TRUE,
returnArray = TRUE,
columns = c("Plate", "Well", "StainA"),
simpleNames = 3,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
fileNames |
(character) provide either explicit list of file-names to be read or leave |
path |
(character) there may be a different path for each file |
fileExtension |
(character) extension of files (default=' |
excludeFiles |
(character) names of files to exclude (only used when reading all files of given directory) |
sheetInd |
(character or integer) specify which sheet to extract (as exact name of sheed or sheet-number, eg |
checkFormat |
(logical) if |
returnArray |
(logical) allows switching from array to list-output |
columns |
(NULL or character) column-headers to be extracted (if specified, otherwise all columns will be extracted) |
simpleNames |
(integer), if |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Details
By default all columns with text-content may be eliminated to keep the numeric part only, which may then get organized to a 3-dim numeric array (where the additional files will be used as 2nd dimension and multiple columns per file shown as 3rd dimension).
NOTE : (starting from version wrMisc-1.5.5) requires packages readxl and
Rcpp being installed !
(This allows much faster and memory efficient processing than previous use of package 'xlsx')
Value
This function returns a list of data.frames
See Also
read_excel; for simple reading of (older) xls-files under 32-bit R one may also see the package RODBC
Examples
path1 <- system.file("extdata", package="wrMisc")
fiNa <- c("pl01_1.xlsx","pl01_2.xlsx","pl02_1.xlsx","pl02_2.xlsx")
datAll <- readXlsxBatch(fiNa, path1)
str(datAll)
## Now let's read all xlsx files of directory
datAll2 <- readXlsxBatch(path=path1, silent=TRUE)
identical(datAll, datAll2)
Reduce table by aggregating smaller groups
Description
reduceTable treats/reduces results from table to 'nGrp' groups,
optional indiv resolution of 'separFirst' (numeric or NULL).
Mainly made for reducing the number of classes for betters plots with pie
Usage
reduceTable(tab, separFirst = 4, nGrp = 15)
Arguments
tab |
output of |
separFirst |
(integer or NULL) optinal separartion of n 'separFirst' groups (value <2 or NULL will priviledge more uniform size of groups, higher values will cause small inital and larger tailing groups) |
nGrp |
(integer) number of groups expected |
Value
This function returns a numeric vector with number of counts and class-borders as names (like table).
See Also
Examples
set.seed(2018); dat <- sample(11:60,200,repl=TRUE)
pie(table(dat))
pie(reduceTable(table(dat), sep=NULL))
pie(reduceTable(table(dat), sep=NULL), init.angle=90,
clockwise=TRUE, col=rainbow(20)[1:15], cex=0.8)
Rescaling According To Reference Data Using Linear Regression.
Description
This function does rescaling: linear transform simple vector 'inDat' that (mean of) elements of names cited in 'refLst' will end up as values 'regrTo'. Regress single vector according to 'refLst' (describing names of inDat). If 'refLst' contains 2 groups, the 1st group will be set to the 1st value of 'regrTo' (and the 2nd group of 'refLst' to the 2nd 'regtTo')
Usage
regrBy1or2point(
inDat,
refLst,
regrTo = c(1, 0.5),
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
inDat |
(matrix or data.frame) data to rescaled |
refLst |
list of names existing in inDat (one group of names for each value in 'regrTo'), to be transformed in values precised in 'regTo'; if no matches to names of 'inDat' found, the 2 lowest and/or highest highest values will be chosen |
regrTo |
(numeric,length=2) range (at scale 0-1) of target-values for mean of elements cited in 'refLst' |
silent |
(logical) suppress messages if |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Value
This function returns a normalized matrix
See Also
adjBy2ptReg, regrMultBy1or2point
Examples
set.seed(2016); dat1 <- 1:50 +(1:50)*round(runif(50),1)
names(dat1) <- 1:length(dat1)
reg1 <- regrBy1or2point(dat1, refLst=c("2","49"))
plot(reg1, dat1)
Rescaling Of Multiple Data-Sets According To Reference Data Using Regression
Description
This function regresses each col of matrix according to 'refLst'(describing rownames of inDat). If 'refLst' conatins 2 groups, the 1st group will be set to the 1st value of 'regrTo' (and the 2nd group of 'refLst' to the 2nd 'regtTo')
Usage
regrMultBy1or2point(
inDat,
refLst,
regrTo = c(1, 0.5),
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
inDat |
(matrix or data.frame) data to be rescaled |
refLst |
list of names existing in inDat (one group of names for each value in 'regrTo'), to be transformed in values precised in 'regTo'; if no matches to names of 'inDat' found, the 2 lowest and/or highest highest values will be chosen |
regrTo |
(numeric,length=2) range (at scale 0-1) of target-values for mean of elements cited in 'refLst' |
silent |
(logical) suppress messages if |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Value
This function returns a normalized matrix
See Also
Examples
set.seed(2016); dat2 <- round(cbind(1:50 +(1:50)*runif(50),2.2*(1:50) +rnorm(50,0,3)),1)
rownames(dat2) <- 1:nrow(dat2)
reg1 <- regrBy1or2point(dat2[,1],refLst=list(as.character(5:7),as.character(44:45)))
reg2 <- regrMultBy1or2point(dat2,refLst=list(as.character(5:7),as.character(44:45)))
plot(dat2[,1],reg2[,1])
identical(reg1,reg2[,1])
identical(dat2[,1],reg2[,1])
Rename columns
Description
This function renames columns of 'refMatr' using 2-column matrix (or data.frame) indicating old and new names (for replacement).
Usage
renameColumns(refMatr, newName, silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
refMatr |
matrix (or data.frame) where column-names should be changed |
newName |
(matrix of character) giving correspondence of old to new names (number of lines must match number of columns of 'refMatr') |
silent |
(logical) suppres messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Value
This function returns a matrix (or data.frame) with renamed columns
Examples
ma <- matrix(1:8,ncol=4,dimnames=list(1:2,LETTERS[1:4]))
replBy1 <- cbind(new=c("dd","bb","z_"),old=c("D","B","zz"))
replBy2 <- matrix(c("D","B","zz","dd","bb","z_"),ncol=2)
replBy3 <- matrix(c("X","Y","zz","xx","yy","z_"),ncol=2)
renameColumns(ma,replBy1)
renameColumns(ma,replBy2)
renameColumns(ma,replBy3)
Reorganize matrix according to clustering-output
Description
Reorganize input matrix as sorted by cluster numbers (and geometric mean) according to vector with cluster names, and index for sorting per cluster and per geometric mean.
In case mat is an array, the 3rd dimension will be considered as 'column' with arguments useColumn ( and cluNo, if it designs a 'column' of mat).
Usage
reorgByCluNo(
mat,
cluNo,
useColumn = NULL,
meanCol = NULL,
addInfo = TRUE,
retList = FALSE,
silent = FALSE,
callFrom = NULL,
debug = FALSE
)
Arguments
mat |
(matrix or data.frame) main input |
cluNo |
(positive integer, length to match nrow(dat) initial cluster numbers for each line of 'mat' (obtained by separate clustering or other segmentation) or may desinn column of |
useColumn |
(character or integer) the columns to use from |
meanCol |
(character or integer) alternative summarizing data for intra-cluster sorting (instead of geometric mean) |
addInfo |
(logical) allows of columns 'index', 'geoMean' and 'cluNo' (or array if |
retList |
(logical) return as list of matrixes (or array if |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) additional messages for debugging |
Value
This function returns a list or array (as 2- or 3 dim) with possible number of occurances for each of the 3 elements in nMax. Read results vertical : out[[1]] or out[,,1] .. (multiplicative) table for 1st element of nMax; out[,,2] .. for 2nd
See Also
pairwise combinations combn, clustering kmeans
Examples
dat1 <- matrix(round(runif(24),2), ncol=3, dimnames=list(NULL,letters[1:3]))
clu <- stats::kmeans(dat1, 5)$cluster
reorgByCluNo(dat1, clu)
dat2 <- cbind(dat1, clu=clu)
reorgByCluNo(dat2, "clu")
Replace NAs By Low Balues
Description
With several screening techniques used in hight-throughput biology values at/below detection limit are returned as NA.
However, the resultant NA-values may be difficult to analyse properly, simply ignoring NA-values mat not be a good choice.
When (technical) replicate measurements are available, one can look for cases where one gave an NA while the other did not
with the aim of investigating such 'NA-neighbours'.
Usage
replNAbyLow(
x,
grp,
quant = 0.8,
signific = 3,
unif = TRUE,
absOnly = FALSE,
seed = NULL,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
(numeric matrix or data.frame) main input |
grp |
(factor) to organize replicate columns of (x) |
quant |
(numeric) quantile form 'neighbour' values to use as upper limit for random values |
signific |
number of signif digits for random values |
unif |
(logical) toggle between uniform and Gaussian random values |
absOnly |
(logical) if TRUE, make negative NA-replacment values positive as absolute values |
seed |
(integer) for use with set.seed for reproducible output |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
replNAbyLow locates and replaces NA values by (random) values from same line & same group 'grp'.
The origin of NAs should be predominantly absence of measure (quantitation) due to signal below limit of detection
and not saturation at upper detection limit or other technical problems.
Note, this approach may be not optimal if the number of NA-neighbours is very low.
Replacamet is done -depending on agrument 'unif'- by Gaussian random model based on neighbour values (within same group),
using their means and sd, or a uniform random model (min and max of neighbour values) .
Then numeric matrix (same dim as 'x') with NA replaced is returned.
Value
This function retuirns a numeric matrix (same dim as 'x') with NA replaced
See Also
Examples
dat <- matrix(round(rnorm(30),2),ncol=6)
grD <- gl(2,3)
dat[sort(sample(1:30,9,repl=FALSE))] <- NA
dat; replNAbyLow(dat,gr=grD)
CV of replicate plates (list of matrixes)
Description
This function calculates CVs of replicates from list of 2 or 3-dim arrays (where 2nd dim is replicates, 3rd dim may be channel). Note : all list-elements of must MUST have SAME dimensions ! When treating data from microtiter plates (eg 8x12) data are typically spread over multiple plates, ie initial matrixes that are the organized into arrays. Returns matrix or array (1st dim is intraplate-position, 2nd .. plate-group/type, 3rd .. channels)
Usage
replPlateCV(lst, silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
lst |
list of matrixes : suppose lines are independent elements, colums are replicates of the 1st column. All matrixes must have same dimensions |
silent |
(logical) suppress messages if |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Value
This function returns a matrix or array (1st dim is intraplate-position, 2nd .. plate-group/type, 3rd .. channels)
See Also
Examples
set.seed(2016); ra1 <- matrix(rnorm(3*96),nrow=8)
pla1 <- list(ra1[,1:12],ra1[,13:24],ra1[,25:36])
replPlateCV(pla1)
arrL1 <- list(a=array(as.numeric(ra1)[1:192],dim=c(8,12,2)),
b=array(as.numeric(ra1)[97:288],dim=c(8,12,2)))
replPlateCV(arrL1)
Replace Separator In Vector Of Pairwise Group-Names This function allows identifying and substituting a separator used in a character vector concatenated of pairwise groups.
Description
Replace Separator In Vector Of Pairwise Group-Names
This function allows identifying and substituting a separator used in a character vector concatenated of pairwise groups.
Usage
replacePWseparator(
compNames,
newSep,
potSep = c("-", "---", "_", "___", ".", "-vs-", "_vs_", "--vs--", "__vs__", " ", " "),
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
compNames |
(character or integer) names of pairwise combined group-names |
newSep |
(character of length=1) new separator between group-names for pair of names; if |
potSep |
(character) potential separators to be checked if occuring in |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a character vector with group-wise substituted separators (or NULL if conflicts appear)
See Also
indexGroupsFromPW, getPWseparator, .getPWseparator
Examples
replacePWseparator(compNames=c("B-C","B-D","C-D"), newSep="-vs-")
Search and Select Groups of Replicates
Description
This function was designed for mining annotation information organized in multiple columns to identify the (potential) grouping of multiple samples, ie to determine factor levels.
The argument method allows further finetuning if high or low number of groups should be preferred, if multiple columns may be combined, or to choose a particular custom column for desiganting factor levels.
Usage
replicateStructure(
x,
method = "median",
sep = "__",
exclNoRepl = TRUE,
trimNames = FALSE,
includeOther = FALSE,
silent = FALSE,
callFrom = NULL,
debug = FALSE
)
Arguments
x |
(matrix or data.frame) the annotation to inspect; each column is supposed to describe another set of annoation/metadata for the rows of |
method |
(character, length=1) the procedure to choose column(s) with properties of information, may be |
sep |
(character) separator used when a method combining multiple columns (eg combAll, combNonOrth) is chosen (should not appear anywhere in |
exclNoRepl |
(logical) decide whether columns with all values different (ie no replicates or max divergency) should be excluded |
trimNames |
(logical) optional trimming of names in |
includeOther |
(logical) include $allCols with pattern of (all) other columns |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) additional messages for debugging |
Details
Statistical tests require specifying which samples should be considered as replicates of whom. In some cases, like the Sdrf-format, automatic mining of such annotation to indentify an experiment's underlying structure of replicates may be challanging, since the key information may not always be found in the same column. For this reason this function allows inspecting all columns of a matrix of data.frame to identify which colmns may serve describing groups of replicates.
The argument exclNoRepl=TRUE allows excluding all columns with different content for each line (like line-numbers), ie information without any replicates.
It is set by default to TRUE to exclude such columns, since statistical tests usually do require some replicates.
When using as method="combAll", there is risk all lines (samples) will be be considered different and no replicates remain.
To avoid this situation the argument can be set to method="combNonOrth".
Using this mode it will be checked if more columns will lead to complete loss of replicates, and -if so- concerned columns omitted.
Value
This function returns a list with $col (column index relativ to x), $lev (abstract labels of level),
$meth (note of method finally used) and $allCols with general replicate structure of all columns of x
See Also
duplicated, uses trimRedundText; for chosing single most likely column describing sample-names and groups of replicates chooseGroupNames
Examples
## a is all different, b is groups of 2,
## c & d are groups of 2 nut NOT 'same general' pattern as b
strX <- data.frame(a=letters[18:11], b=letters[rep(c(3:1,4), each=2)],
c=letters[rep(c(5,8:6), each=2)], d=letters[c(1:2,1:3,3:4,4)],
e=letters[rep(c(4,8,4,7),each=2)], f=rep("z",8) )
strX
replicateStructure(strX[,1:2])
replicateStructure(strX[,1:4], method="combAll")
replicateStructure(strX[,1:4], method="combAll", exclNoRepl=FALSE)
replicateStructure(strX[,1:4], method="combNonOrth", exclNoRepl=TRUE)
replicateStructure(strX, method="lowest")
replicateStructure(strX, method=3, includeOther=TRUE) # custom choice of 3rd column
Remove Lines Of Matrix Redundant /Duplicated For 1st And 2nd Column
Description
This function removes lines of matrix that are redundant /duplicated for 1st and 2nd column (irrespective of content of their columns). The first occurance of redundant /duplicated elements is kept.
Usage
rmDupl2colMatr(
mat,
useCol = c(1, 2),
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
mat |
(matrix or data.frame) main input |
useCol |
(integer, length=2) columns to consider/use when looking for duplicated entries |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a matrix where duplictaed lines are removed
See Also
Examples
mat <- matrix(1:12,ncol=3)
mat[3,1:2] <- mat[1,1:2]
rmDupl2colMatr(mat)
Remove or rename enumerator tag/name (or remove entire enumerator) from tailing enumerators
Description
This function allows indentifying, removing or renaming enumerator tag/name (or remove entire enumerator) from tailing enumerators (eg 'abc_No1' to 'abc_1'). A panel of potential candidates as combination of separator-symbols and separtor text/words will be tested to find if one matches all data. In case the main input is a matrix, all columns will be tested independently to find the first column where one specific combination of separator-symbols and separtor text/words is found. Several options exist for the output, the combination of separator-symbols and separtor text/words may be included, too.
Usage
rmEnumeratorName(
dat,
nameEnum = c("Number", "No", "#", "Replicate", "Sample"),
sepEnum = c(" ", "-", "_", "/"),
newSep = "",
incl = c("anyCase", "trim2"),
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat |
(character vecor or matrix) main input |
nameEnum |
(character) potential enumerator-names |
sepEnum |
(character) potential separators for enumerator-names |
newSep |
(character) potential enumerator-names |
incl |
(character) options to include further variants of the enumerator-names,
use |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
In case only digit-enumerators are present (ie, without repetitive text), one has to use incl="rmEnum" to remove terminal enumerators.
This will work, only when all items do contain terminal digits.
Please note, that checking a variety of different separator text-word and separator-symbols may give an important number of combinations to check.
In particular, when automatic trimming of separator text-words is added (eg incl="trim2"), the complexity of associated searches increases quickly.
Thus, with large data-sets restricting the content of the arguments nameEnum, sepEnum and (in particular) newSep to the most probable terms/options
is suggested to help reducing demands on memory and CPU.
In case the input dat is a matrix and multiple different numerator-types are found, only the first colum (from the left) will be treated.
If you which to remove/subsitute mutiple types of enumerators the function rmEnumeratorName must be run independently, see last example below.
Value
This function returns a corrected vector (or matrix), or a list if incl="rmEnumL" containing $dat (corrected data),
$pattern (the combination of separator-symbols and separtor text/words found), and if input is matrix $column (which column of the input was identified and treated)
See Also
when the exact pattern is known grep and sub may allow direct manipulations much faster
Examples
xv <- c("hg_1","hjRe2_2","hk-33")
rmEnumeratorName(xv)
rmEnumeratorName(xv, incl="rmEnum")
xx <- c("hg_Re1","hjRe2_Re2","hk-Re3_Re33")
rmEnumeratorName(xx)
rmEnumeratorName(xx, newSep="--")
rmEnumeratorName(xx, incl="anyCase")
xy <- cbind(a=11:13, b=c("11#11","2_No2","333_samp333"), c=xx)
rmEnumeratorName(xy)
rmEnumeratorName(xy,incl=c("anyCase","trim2","rmEnumL"))
xz <- cbind(a=11:13, b=c("23#11","4#2","567#333"), c=xx)
apply(xz, 2, rmEnumeratorName, sepEnum=c("","_"), newSep="_", silent=TRUE)
Remove or Reassign Orphan Indexes
Description
This function allows detecting terminal orphans of a vector of (cluster-) indexes and removing (ie marking as NA)
or re-assigning them to the neighbour class towrds the center.
Usage
rmOrphans(
ind,
minN = 1,
reassign = FALSE,
side = "both",
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
ind |
(integer) main input of (cluster-) indexes |
minN |
(numeric, length=1) the min frequency to consider as orphans, if less than 1 it will be interpreted as ratio compared to length of |
reassign |
(logical) if |
side |
(character) may be 'both', 'b', 'upper', 'u', 'lower' or 'l' to decide if lower and/or upper end indexes should be treated. |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Details
All input of ind is supposed to be interger values as (cluster-) indexes.
This function will look if the lowest and/or highest (cluster-) indexes appear at very low frequency so that they may be considered orphans.
The argument minN assigns the threshold of when the frquency of terminal values may be considered as 'orphan',
either as absolute threshold or if less than 1 as ratio (0.1 => 10
The argument side may be 'both', 'b', 'upper', 'u', 'lower' or 'l', to decide if lower and/or upper end indexes should be treated.
Value
This function returns an integer vector of adjusted indexes
See Also
Examples
x=c(3:1,3:4,4:6,5:3); rmOrphans(x)
rmOrphans(x, minN=0.2)
## reassign orphans to neighbour center class
cbind(x, x=x, def=rmOrphans(x, reassign=TRUE),
minN=rmOrphans(x, minN=0.2, reassign=TRUE) )
Trim/Remove Redundant Words
Description
This function allows removing shared words, ie triming to non-redundant words.
Usage
rmSharedWords(
x,
sep = c("_", " ", "."),
anySep = TRUE,
newSep = NULL,
minLe = 2,
na.omit = FALSE,
fixed = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
(character) main input for making non-redundant |
sep |
(character) separator(s) to be used |
anySep |
(logical) if |
newSep |
(character) new (uniform) separator between words, if |
minLe |
(integer) minimum length for allowing being recognised as 'word' |
na.omit |
(logical) if |
fixed |
(logical) will be transmitted to argument |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Details
Heading separators will be removed in any case (even if not followed by a 'word').
Special characters will be automatically protected. When looking for repeated words, the order of such words does NOT matter, multiple repeats will be removed, too.
Value
This function returns character vector of same length (unless na.omit=TRUE), simply with modified text-content
See Also
Examples
x1 <- c("aa_A1 yy_zz.txt", NA, "B2 yy_aa_aa_zz.txt")
rmSharedWords(x1)
Normal random number generation with close fit to expected mean and sd
Description
This function allows creating a vector of random values similar to rnorm, but resulting value get recorrected to fit to expected mean and sd.
When the number of random values to generate is low, the mean and sd of the resultant values may deviate from the expected mean and sd when using the standard rnorm function.
In such cases the function rnormW helps getting much closer to the expected mean and sd.
Usage
rnormW(
n,
mean = 0,
sd = 1,
seed = NULL,
digits = 8,
silent = FALSE,
callFrom = NULL
)
Arguments
n |
(integer, length=1) number of observations. If |
mean |
(numeric, length=1) expected mean |
sd |
(numeric, length=1) expected sd |
seed |
(integer, length=1) seed for generating random numbers |
digits |
(integer, length=1 or |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
Details
For making result reproducible, a seed for generating random numbers can be set via the argument seed.
However, with n=2 the resulting values are 'fixed' since no random component is possible at n <3.
Value
This function returns a numeric vector of random values
See Also
Examples
x1 <- (11:16)[-5]
mean(x1); sd(x1)
## the standard way
ra1 <- rnorm(n=length(x1), mean=mean(x1), sd=sd(x1))
## typically the random values deviate (slightly) from expected mean and sd
mean(ra1) -mean(x1)
sd(ra1) -sd(x1)
## random numbers with close fit to expected mean and sd :
ra2 <- rnormW(length(x1), mean(x1), sd(x1))
mean(ra2) -mean(x1)
sd(ra2) -sd(x1) # much closer to expected value
rowCVs
Description
This function returns CV for values in each row (using speed optimized standard deviation). Note : NaN values get replaced by NA.
Usage
rowCVs(dat, autoconvert = NULL, silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
dat |
(numeric) matix |
autoconvert |
(NULL or character) allows converting simple vectors in matrix of 1 row (autoconvert="row") |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Value
This function returns a (numeric) vector with CVs for each row of 'dat'
See Also
colSums, rowSds, rowGrpCV, colCVs
Examples
set.seed(2016); dat1 <- matrix(c(runif(200) +rep(1:10,20)), ncol=10)
head(rowCVs(dat1))
Row group CV
Description
This function calculates CVs for matrix with multiple groups of data, ie one CV for each group of data. Groups are specified as columns of 'x' in 'grp' (so length of grp should match number of columns of 'x', NAs are allowed)
Usage
rowGrpCV(x, grp, means = NULL, listOutp = FALSE)
Arguments
x |
numeric matrix where relplicates are organized into separate columns |
grp |
(factor) defining which columns should be grouped (considered as replicates) |
means |
(numeric) alternative values instead of means by .rowGrpMeans() |
listOutp |
(logical) if TRUE, provide output as list with $CV, $mean and $n |
Value
This function returns a matrix of CV values
See Also
Examples
set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10)
head(rowGrpCV(dat1, gr=gl(4,3,labels=LETTERS[1:4])[2:11]))
Row-Means With Destinction Of Groups (Of Columns, eg Groups Of Replicates)
Description
Thus function calculates column-means for matrix with multiple groups of data, ie similar to rowMeans but one mean for each group of data. Groups are specified as columns of 'x' in 'grp' (so length of grp should match number of columns of 'x', NAs are allowed).
Usage
rowGrpMeans(
x,
grp,
na.rm = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
(numeric matrix or data.frame) main input |
grp |
(character or factor) defining which columns should be grouped (considered as replicates) |
na.rm |
(logical) a logical value indicating whether |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) This function allows easier tracking of messages produced |
Value
This function returns a matrix with mean values
See Also
rowSds, colSums which also shows colMeans
Examples
set.seed(2016); dat1 <- matrix(c(runif(200) +rep(1:10,20)), ncol=10)
head(rowGrpMeans(dat1, gr=gl(4, 3, labels=LETTERS[1:4])[2:11]))
Count Number Of NAs Per Row And Group Of Columns
Description
This functions allows easy counting of the number of NAs per row and group in data organized multiple sub-groups (in columns).
Usage
rowGrpNA(
mat,
grp = NULL,
initColOrder = TRUE,
mode = "simple",
digits = 2,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
mat |
(matrix, data.frame, list or 'MArrayLM') data to count the number of |
grp |
(character or factor) defining which columns should be grouped (considered as replicates). If |
initColOrder |
(logical) if |
mode |
(character) allows to switch between different types of output :
|
digits |
(integer, length=1) number of decimal digits from rounding (when ratios are calculated); |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Details
First of all, this function allows counting the number of NAs per line and sub-group of columns as defined by argument grp.
Furthermore, the counting can be expressed relative to the size of the sub-groups, either as ratio or by giving the NA-count
using mode and all results may also get collasped in as single (character) vector, however, the names of the groups do not get conserved.
This function has several options via tehe argument 'mode':
- mode="simple" will return simply the number of NAs per line and group as integer;
- mode="simpleCollapse" will collapse all columns into single chain of characters with the number of NAs per line and group (as character);
- mode="complete" will return number of NAs per line and group accompanied by the number of columns associated with the very group (as character);
- mode="completeCollapse" will collapse all columns into single chain of characters with the number of NAs per line and group accompanied by the number of columns associated with the very group (as character);
- mode="ratio" will return the ratio of NAs per line and group (as numeric);
- mode="ratioCollapse" will collapse all columns into single chain of characters with the ratio of NAs per line and group(as character);
With mode="complete" or mode="ratio" the resulting column-names will state 'nNA.' plus 'ratio.' (if a ratio-mode was chosen).
Value
This function returns a matrix (or numeric vector if all grouping falls in a single class or charcter-vector if all groups get collapsed in single chain of characters) with number of NAs per group
See Also
Examples
mat2 <- matrix(1:72, nrow=9, ncol=8, dimnames=list(letters[1:9],LETTERS[1:8]))
set.seed(2025); mat2[sample.int(prod(dim(mat2)), 2*nrow(mat2), replace=FALSE)] <- NA
set.seed(2026); grp2 <- as.factor(sample.int(n=3, size=ncol(mat2), replace=TRUE))
table(grp2)
## overal number of NAs per row
rowSums(is.na(mat2))
## number of NAs per row and group
head(rowGrpNA(mat2, grp2))
head(rowGrpNA(mat2, grp2, mode="complete"))
head(rowGrpNA(mat2, grp2, mode="ratio"))
## mimick output from testing from package wrProteo
dat1 <- list(isNA =is.na(mat2), setup=list(grp=grp2))
head(rowGrpNA(dat1, mode="simple"))
head(rowGrpNA(dat1, mode="complete"))
head(rowGrpNA(dat1, mode="ratioCollapse"))
Per line and per group sd-values
Description
rowGrpSds calculate Sd (standard-deviation) for matrix with multiple groups of data, ie one sd for each group of data.
Groups are specified as columns of 'x' in 'grp' (so length of grp should match number of columns of 'x', NAs are allowed).
Usage
rowGrpSds(x, grp)
Arguments
x |
matrix where relplicates are organized into seprate columns |
grp |
(character or factor) defining which columns should be grouped (considered as replicates) |
Value
This function returns a matrix of sd values
See Also
rowGrpMeans, rowCVs, rowSEMs,sd
Examples
set.seed(2016); dat1 <- matrix(c(runif(200) +rep(1:10,20)), ncol=10)
head(rowGrpSds(dat1, gr=gl(4,3,labels=LETTERS[1:4])[2:11]))
rowSums with destinction of groups (of columns, eg groups of replicates)
Description
This function calculates row-sums for matrix with multiple groups of data, ie similar to rowSums but one summed value for each line and group of data.
Groups are specified as columns of 'x' in 'grp' (so length of grp should match number of columns of 'x', NAs are allowed).
Usage
rowGrpSums(x, grp, na.rm = TRUE)
Arguments
x |
matrix or data.frame |
grp |
(character or factor) defining which columns should be grouped (considered as replicates) |
na.rm |
(logical) a logical value indicating whether |
Value
This function a matrix with row/group sum values
See Also
rowGrpMeans, rowGrpSds, rowSds, colSums
Examples
set.seed(2016); dat1 <- matrix(c(runif(200) +rep(1:10,20)), ncol=10)
head(rowGrpMeans(dat1, gr=gl(4, 3, labels=LETTERS[1:4])[2:11]))
Estimate sd Of Median For Each Row By Bootstrap
Description
This function determines the stand error (sd) of the median for each row by bootstraping each row of 'dat'. Note: requires package boot
Usage
rowMedSds(dat, nBoot = 99, silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
dat |
(numeric) matix, main input |
nBoot |
(integer) number if iterations for bootstrap |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Value
This functions returns a (numeric) vector with estimated sd values
See Also
For a more flexible version able to handle lists please look at colMedSds , based on boot
Examples
set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)), ncol=10)
rowMedSds(dat1) ; plot(rowSds(dat1), rowMedSds(dat1))
Row Normalize
Description
This function was designed for normalizing data that is supposed to be particularly similar, like a collection of technical replicates.
Thus, initially for each row an independent normalization factor is calculated and the median or mean across all factors will be finally applied to the data.
This function has a special mode of operation with higher content of NA values (which may pose problems with other normalization approaches).
If the NA-content is higher than the threshold set in sparseLim,
a special procedure for sparse data will be applied (iteratively trating subsets of nCombin columns that will be combined in a later step).
Usage
rowNormalize(
dat,
method = "median",
refLines = NULL,
refGrp = NULL,
proportMode = TRUE,
minQuant = NULL,
sparseLim = 0.4,
nCombin = 3,
omitNonAlignable = FALSE,
maxFact = 10,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat |
matrix or data.frame of data to get normalized |
method |
(character) may be "mean","median" (plus "NULL","none"); When NULL or 'none' is chosen the input will be returned as is |
refLines |
(NULL or numeric) allows to consider only specific lines of 'dat' when determining normalization factors (all data will be normalized) |
refGrp |
(integer) Only the columns indicated will be used as reference, default all columns (integer or colnames) |
proportMode |
(logical) decide if normalization should be done by multiplicative or additive factor |
minQuant |
(numeric) optional filter to set all values below given value as |
sparseLim |
(integer) decide at which min content of |
nCombin |
(NULL or integer) used only in sparse-mode (ie if content of |
omitNonAlignable |
(logical) allow omitting all columns which can't get aligned due to sparseness |
maxFact |
(numeric, length=2) max normalization factor |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Details
Arguments were kept similar with function normalizeThis as much as possible.
In most cases data get normalized by proportional factors. In case of log2-data (very common in omics-data) normalizing by an additive factor is equivalent to a proportional factor.
This function has a special mode of operation for sparse data (ie containing a high content of NA values).
0-values by themselves will be primarily considered as true measurment outcomes and not as missing.
However, by using the argument minQuant all values below a given threshold will be set as NA and this may possibly trigger the sparse mode of normalizing.
Note : Using a small value of nCombin will give the highest chances of finding sufficient complete combination of columns with sparse data.
However, this will also increase (very much) the computational efforts and time required to produce an output.
When using default proportional mode a potential division by 0 could occur, when the initial normalization factor turns out as 0.
In this case a small value (default the maximum value of dat / 10 will be added to all data before normalizing.
If this also creates 0-vales in the data this factor will be multiplied by 0.03.
Value
This function returns a matrix of normalized data
See Also
normalizeThis, exponNormalize, adjBy2ptReg, justvsn
Examples
## sparse matrix normalization
set.seed(2); AA <- matrix(rbinom(110,10,0.05), nrow=10)
AA[,4:5] <- AA[,4:5] *rep(4:3, each=nrow(AA))
AA[2,c(2,6,7)] <- 1; AA[3,8] <- 1;
(AA1 <- rowNormalize(AA))
(AA2 <- rowNormalize(AA, minQuant=1)) # set all 0 as NAs
(AA3 <- rowNormalize(AA, refLines=1:6, omitNonAlignable=FALSE, minQuant=1))
SEM for each row
Description
This function speed optimized SEM (standard error of the mean) for each row. The function takes a matrix or data.frame and treats each row as set of data for SEM; NAs are ignored from data. Note: NaN instances will be transformed to NA
Usage
rowSEMs(dat)
Arguments
dat |
matrix or data.frame |
Value
This function returns a numeric vector with SEM values
See Also
Examples
set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10)
head(rowSEMs(dat1))
sd for each row (fast execution)
Description
This function is speed optimized sd per row of a matrix or data.frame and treats each row as independent set of data for sd (equiv to apply(dat,1,sd)).
NAs are ignored from data unless entire line NA). Speed improvements may be seen at more than 100 lines.
Note: NaN instances will be transformed to NA
Usage
rowSds(dat, silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
dat |
matrix (or data.frame) with numeric values (may contain NAs which will be ignored) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Value
numeric vector of sd values
See Also
Examples
set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10)
rowSds(dat1)
Locate Sample Index From Index Or Name Of Pair-Wise Comparisons In List Or MArrayLM-Object
Description
When multiple series of data are tested simultaneaously (eg using moderTestXgrp), multiple pairwise comparisons get performed.
This function helps locating the groups of samples, eg respective mean-columns, corresponding to specific pairwise comparisons.
Usage
sampNoDeMArrayLM(
MArrayObj,
useComp = NULL,
outTy = "index",
groupSep = NULL,
combPwSep = "combine1",
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
MArrayObj |
(list or MArray-object) main input, object to examine and extract pairwise question information |
useComp |
(character or integer, length=1) index or name of pairwise-comparison to be addressed |
outTy |
(character) choose if just vector of indexes (with |
groupSep |
(NULL or character of length=1) separator for pair of names; if |
combPwSep |
(character) sequence of separators for building combined names (may be combPwSep='combine1' or 'combine2'); will be used in pwSeparatorList() |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
As main input one gives a list or MArrayLM-object containing testing results from pairwise comparisons,
and specific comparisons indicated by useComp to get located in the elements of mean-columns (lstMeans).
Note, that that the numeric indexes should be used with caution as they refer to the levels of the groups which are sorted and thus not necessarily in the order of other elements like the group-means.
This function allows finding inverted questions (eg 'D-C' even though 'C-D' was actually run in testing), but the result will always be presented in the initial order
Value
This function returns if outTy="names" a numeric vector with indexes indicating the sorted (!!) columns of (replicate) mean-values corresponding to the comparison specified in useComp;
or if outTy="names" or outTy="pwGrpNa" : the (separated) names of pairwise groups will be returned as matrix (each pairwise question as separate line)
or if outTy="list" a list with $index0 (sorted unique vector or indexes), $pwGrpNa (the separated pairwise group-names), $pwIndex (the ith pairwise comparison), $concat (the concatenated pairwise names), $sep (pairwise separator) and $compIndex
See Also
moderTestXgrp, this function gets used eg in MAplotW or VolcanoPlotW
Examples
grp3 <- factor(rep(LETTERS[4:2], c(2,3,3)))
set.seed(2017); t8 <- matrix(round(rnorm(208*8,10,0.4), 2), ncol=8,
dimnames=list(paste(letters[],rep(1:8,each=26),sep=""), paste0(grp3,c(1:2,1:3,1:3))))
if(requireNamespace("limma", quietly=TRUE)) { # need limma installed...
test8 <- moderTestXgrp(t8, grp3, useComparison="all")
head(test8$p.value) # all pairwise comparisons available
sampNoDeMArrayLM(test8, 3)
levels(grp3)[sampNoDeMArrayLM(test8, 3)]
head(test8$means[,sampNoDeMArrayLM(test8, 3, outTy="names")], 3)
head(test8$means[,sampNoDeMArrayLM(test8, "D-C", outTy="names")], 3) # inverted question
}
Rescale Data To Given Minimum- And Maxiumum- Values
Description
This function allows convenient rescaling of data in the sence that the range covered will be adjusted to user-specified values. Instead of fixed min and max values for the output it is also possible to fix 2 given quantiles for user-specified values (and rescale by linear transformation).
Usage
scaleXY(
x,
min = 0,
max = NULL,
q = c(0, 1),
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
(numeric vector, matrix or data.frame) object to rescacle |
min |
(numeric) minimum value in output, if of length=2 and max not given/valid its 2nd value will be used as max |
max |
(numeric) maximum value in output, defaults to 1 if not specified or use 2nd value of min (if min of length=2) |
q |
(numeric, length=2) vector giving quantile values to be used for setting frame of normalization (defaults to lowest and highest values expected) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a vector (or matrix) of rescaled data (in dimensions of input)
See Also
scale, normalizeThis, blockNormalize
Examples
## simple vector
scale(11:19) # standardizes (base R), is not 'rescaling'
scaleXY(11:19) # range form 0 to 1
scaleXY(11:19, min=1, max=10)
scaleXY(11:19, c(1, 10)) # min & max as single argument
# rescale matrix with NA
## rescale to 20th and 80th quantile (ie other than min or max)
scaleXY(11:19, min=1, max=10, q=c(0.2, 0.8))
## rescale matrix with NA
mat1 <- matrix(11:20, ncol=2, dimnames=list(letters[1:5], c("A","B")))
mat1[2,1] <- NA
scaleXY(mat1)
scaleXY(mat1, min=1, max=10, q=c(0.2, 0.8))
## rescale for each column individually
dat2 <- apply(mat1, 2, scaleXY, 1, 100)
range(dat2)
summary(dat2)
Search duplicated data over multiple columns, ie pairs of data
Description
searchDataPairs searches matrix for columns of similar data, ie 'duplicate' values in separate columns or very similar columns if realDupsOnly=FALSE.
Initial distance measures will be normalized either to diagonale (normRange=TRUE) of 'window' or to the real max distance observed (equal or less than diagonale).
Return data.frame with names for sample-pair, percent of identical values (100 for complete identical pair) and relative (Euclidean) distance (ie max dist observed =1.0).
Note, that low distance values do not necessarily imply correlating data.
Usage
searchDataPairs(
dat,
disThr = 0.01,
byColumn = TRUE,
normRange = TRUE,
altNa = NULL,
realDupsOnly = TRUE,
silent = FALSE,
callFrom = NULL
)
Arguments
dat |
matrix or data.frame (main input) |
disThr |
(numeric) threshold to decide when to report similar data (applied on normalized distances, low val fewer reported), applied on normalized distances (norm to diagonale of all data for best relative 'unbiased' view) |
byColumn |
(logical) rotates main input by 90 degrees (using |
normRange |
(logical) normize each columns separately if |
altNa |
(character, default |
realDupsOnly |
(logical) if |
silent |
(logical) suppres messages |
callFrom |
(character) allows easier tracking of messages produced |
Value
This function returns a data.frame with names of sample-pairs, percent of identical values (100 for complete identical pair) and rel (Euclidean) distance (ie max dist observed =1.0)
See Also
Examples
mat <- round(matrix(c(11:40,runif(20)+12,11:19,17,runif(20)+18,11:20), nrow=10), 1)
colnames(mat) <- 1:9
searchDataPairs(mat,disThr=0.05)
Search Points Forming Lines At Given Slope
Description
This function searches among set of points (2-dim) those forming line(s) with user-defined slope ('coeff'), ie search optimal (slope-) offset parameter(s) for (regression) line(s) with given slope ('coef'). Note: larger data-sets : segment residuals to 'coeff' & select most homogenous
Usage
searchLinesAtGivenSlope(
dat,
coeff = 1.5,
filtExtr = c(0, 1),
minMaxDistThr = NULL,
lmCompare = TRUE,
indexPoints = TRUE,
displHist = FALSE,
displScat = FALSE,
bestCluByDistRat = TRUE,
neighbDiLim = NULL,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat |
matrix or data.frame, main input |
coeff |
(numeric) slope to consider |
filtExtr |
(integer) lower & upper quantile values, remove points with extreme deviation to offset=0, (if single value: everything up to or after will be used) |
minMaxDistThr |
(logical) optional minumum and maximum distance threshold |
lmCompare |
(logical) add'l fitting of linear regression to best results, return offset AND slope based on lm fit |
indexPoints |
(logical) return results as list with element 'index' specifying retained points |
displHist |
(logical) display histogram of residues |
displScat |
(logical) display (simple) scatter plot |
bestCluByDistRat |
(logical) initial selection of decent clusters based on ratio overallDist/averNeighbDist (or by CV & cor) |
neighbDiLim |
(numeric) additional threshold for (trimmed mean) neighbour-distance |
silent |
(logical) suppress messages |
debug |
(logical) for bug-tracking: more/enhanced messages |
callFrom |
(character) allow easier tracking of messages produced |
Details
Note: The package MASS is required when using as lmCompare=TRUE.
For larger data the function will try using the package NbClust (available from CRAN) if installed.
Value
This functions returns a matrix of line-characteristics (or if indexPoints is TRUE then list (line-characteristics & index & lm-results)
See Also
Examples
set.seed(2016); ra1 <- runif(300)
dat1 <- cbind(x=round(c(1:100+ra1[1:100]/5,4*ra1[1:50]),1),
y=round(c(1:100+ra1[101:200]/5, 4*ra1[101:150]), 1))
(li1 <- searchLinesAtGivenSlope(dat1, coeff=1))
Simple Figure Showing Line From Start- To End-Sites Of Edges (Or Fragments) Defined By Their Start- And End-Sites This function draws av figure showing start- and end-sites of edges (or fragments) .
Description
Simple Figure Showing Line From Start- To End-Sites Of Edges (Or Fragments) Defined By Their Start- And End-Sites
This function draws av figure showing start- and end-sites of edges (or fragments) .
Usage
simpleFragFig(
frag,
fullSize = NULL,
sortByHead = TRUE,
useTit = NULL,
useCol = NULL,
displNa = TRUE,
useCex = 0.7
)
Arguments
frag |
(matrix) 2 columns defining begin- and end-sites (as interger values) |
fullSize |
(integer) optional max size used for figure (x-axis) |
sortByHead |
(logical) sort by begin-sites (if |
useTit |
(character) custom title |
useCol |
(character) specify colors, if numeric vector will be onsidered as score values |
displNa |
(character) display names of edges (figure may get crowded) |
useCex |
(numeric) expansion factor, see also |
Value
This function returns a plot only
See Also
buildTree, countSameStartEnd, contribToContigPerFrag,
Examples
frag2 <- cbind(beg=c(2,3,7,13,13,15,7,9,7, 3,7,5,7,3),end=c(6,12,8,18,20,20,19,12,12, 4,12,7,12,4))
rownames(frag2) <- c("A","E","B","C","D","F","H","G","I", "J","K","L","M","N")
simpleFragFig(frag2, fullSize=21, sortByHead=TRUE)
buildTree(frag2)
2-factorial Anova on single line of data
Description
This function runs 2-factorial Anova on a single line of data (using aov from package stats)
using a model with two factors (without factor-interaction) and extracts the correpsonding p-value.
Usage
singleLineAnova(
dat,
fac1,
fac2,
inclInteraction = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat |
numeric vector |
fac1 |
(character or factor) vector describing grouping elements of dat for first factor, must be of same langth as fac2 |
fac2 |
(character or factor) vector describing grouping elements of dat for second factor, must be of same langth as fac1 |
inclInteraction |
(logical) decide if factor-interactions (eg synergy) should be included to model |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns the (uncorrected) p for factor 'Pr(>F)' (see aov)
See Also
aov, anova; for repeated tests using the package limma including lmFit and eBayes see test2factLimma
Examples
set.seed(2012); dat <- round(runif(8),1)
singleLineAnova(dat, gl(2,4),rep(1:2,4))
Sort matrix by two categorical and one integer columns
Description
This function sorts matrix 'mat' subsequently by categorical and numerical columns of 'mat', ie lines with identical values for categor are sorted by numeric value.
Usage
sortBy2CategorAnd1IntCol(
mat,
categCol,
numCol,
findNeighb = TRUE,
decreasing = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
mat |
matrix (or data.frame) from which by 2 columns will be selected for sorting |
categCol |
(integer or character) which columns of 'mat' to be used as categorical columns |
numCol |
(integer or character) which column of 'mat' to be used as integer columns |
findNeighb |
(logical) if 'findNeighb' neighbour cols according to 'numCol' will be identified as groups & marked in new col 'neiGr', orphans marked as NA |
decreasing |
(logical) order of sort |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a sorted matrix (same dimensions as 'mat')
Examples
mat <- cbind(aa=letters[c(3,rep(7:8,3:4),4,4:6,7)],bb=LETTERS[rep(1:5,c(1,3,4,4,1))],
nu=c(23:21,23,21,22,18:12))
mat[c(3:5,1:2,6:9,13:10),]
sortBy2CategorAnd1IntCol(mat,cate=c("bb","aa"),num="nu",findN=FALSE,decr=TRUE)
sortBy2CategorAnd1IntCol(mat,cate=c("bb","aa"),num="nu",findN=TRUE,decr=FALSE)
Make A List Of Common Occurances Sorted By Number Of Repeats
Description
The aim of this function is to count the number of occurances of words when comaring separate vectors (x, y and z) or from a list (given as x)
and to give an output sorted by their frequency.
The output lists the various values/words by their frequency, the names of the resulting list-elements indicate number of times the values/words were found repeated.
Usage
sortByNRepeated(
x,
y = NULL,
z = NULL,
filterIntraRep = TRUE,
silent = TRUE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
(list, character or integer) main input, if list, arguments |
y |
(character or integer) supplemental vector to comare with |
z |
(character or integer) supplemental vector to comare with |
filterIntraRep |
(logical) allow making vectors |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
In order to compare the frquency of values/words between separate vectors or vectors within a list, it is necessary that these have been made unique before calling this function or using filterIntraRep=TRUE.
In case the input is given as list (in x), there is no restriction to the number of vectors to be compared.
With very long lists, however, the computational effort incerases (like it does when using table)
Value
This function returns a list sorted by number of occurances. The names of the list indicate the number of repeats.
See Also
Examples
sortByNRepeated(x=LETTERS[1:11], y=LETTERS[3:13], z=LETTERS[6:12])
sortByNRepeated(x=LETTERS[1:11], y=LETTERS[c(3:13,5:4)], z=LETTERS[6:12])
Estimate Mode (Most Frequent Value)
Description
Estimate mode, ie most frequent value. In case of continuous numeric data, the most frequent values may not be the most frequently repeated exact term. This function offers various approches to estimate the mode of a numeric vector. Besides, it can also be used to identify the most frequentexact term (in this case also from character vectors).
Usage
stableMode(
x,
method = "density",
finiteOnly = TRUE,
bandw = NULL,
rangeSign = 1:6,
silent = FALSE,
callFrom = NULL,
debug = FALSE
)
Arguments
x |
(numeric, or character if 'method='mode') data to find/estimate most frequent value |
method |
(character) There are 3 options : BBmisc, binning and density (default). If "binning" the function will search context dependent, ie like most frequent class of histogram. Using "binning" mode the search will be refined if either 80 percent of values in single class or >50 percent in single class. |
finiteOnly |
(logical) suppress non-finite values; allows avoiding |
bandw |
(integer) only used when |
rangeSign |
(integer) only used when |
silent |
(logical) suppress messages |
callFrom |
(character) allows easier tracking of messages produced |
debug |
(logical) additional messages for debugging |
Details
The argument method allows to choose among (so far) 4 different methods available.
If "density" is chosen, the most dense region of sqrt(n) values will be chosen;
if "binning", the data will be binned (like in histograms) via rounding to a user-defined number of significant values ("rangeSign").
If method is set to "BBmisc", the function computeMode() from package BBmisc will be used.
If "mode" is chosen, the first most frequently occuring (exact) value will be returned, if "allModes", all ties will be returned. This last mode also works with character input.
Value
This function returns a numeric vector with value of mode, the name of the value indicates it's position
See Also
computeMode() in package BBmisc
Examples
set.seed(2012); dat <- round(c(rnorm(50), runif(100)),3)
stableMode(dat)
Standardize (scale) data
Description
This functions work similar to scale, however, it evaluates the entire input and not column-wise (and independeltly as scale does).
With Standarizing we speak of transforming the data to end up with mean=O and sd=1.
Furthermore, in case of 3-dim arrays, this function returns also an object with the same dimensions as the input.
Usage
standardW(
mat,
byColumn = FALSE,
na.rm = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
mat |
(matrix, data.frame or array) data that need to get standardized. |
byColumn |
(logical) if |
na.rm |
(logical) if |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This functions retruns a vector of rescaled data (in dimensions as input)
See Also
Examples
dat <- matrix(2*round(runif(100),2), ncol=4)
mean(dat); sd(dat)
dat2 <- standardW(dat)
apply(dat2, 2, sd)
summary(dat2)
dat3 <- standardW(dat, byColumn=TRUE)
apply(dat2, 2, sd)
summary(dat2)
mean(dat2); sd(dat2)
Standard Eror Of Median by Boot-Strap
Description
stdErrMedBoot estimate standard eror of median by bootstrap approach.
Note: requires package boot
Usage
stdErrMedBoot(x, nBoot = 9, silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
x |
(numeric) vector to estimate median and it's standard error |
nBoot |
(integer) number for iterations |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Value
This function returns a (numeric) vector with estimated standard error
See Also
colMedSds and rowMedSds; based on boot
Examples
set.seed(2014); ra1 <- c(rnorm(9,2,1),runif(8,1,2))
rat1 <- ratioAllComb(ra1[1:9],ra1[10:17])
median(rat1); stdErrMedBoot(rat1)
Count number of NAs per sub-set of columns
Description
This function will count the number of NAs per group (defined by argument grp) while summing over all lines of a matrix or data.frame.
The row-position has no influence on the counting.
Using the argument asRelative=TRUE the result will be given as (average) number of NAs per row and group.
Usage
sumNAperGroup(
x,
grp,
asRelative = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
matrix or data.frame which may contain |
grp |
factor describing which column of 'dat' belongs to which group |
asRelative |
(logical) return as count of |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns an integer vector with count of NAs per group
See Also
NA, filter NAs by line presenceFilt
Examples
mat <- matrix(1:25, ncol=5)
mat[lower.tri(mat)] <- NA
sumNAperGroup(mat, rep(1:2,c(3,2)))
sumNAperGroup(mat, rep(1:2,c(3,2)), asRelative=TRUE)
Summarize columns (as median,mean,min,last or other methods)
Description
summarizeCols summarizes all columns of matrix (or data.frame).
In case of text-columns the sorted middle (~median) will be given, unless 'maxAbsLast', 'minAbsLast',
.. consider only last column of 'matr' : choose from all columns the line where (max of) last col is at min;
'medianComplete' or 'meanComplete' consideres only lines/rows where no NA occur (NA have influence other columns !)
Usage
summarizeCols(
matr,
meth = "median",
refCol = NULL,
nEqu = FALSE,
supl = NULL,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
matr |
data.frame matrix of data to be summarized by comlumn (may do different method for text and numeric comlumns) |
meth |
(character) summarization method, may be 'mean','aver','median','sd','CV', 'min','max','first','last','maxOfRef','minOfRef','maxAbsLast','minAbsLast',
'medianComplete' or 'meanComplete', 'n' (number of non- |
refCol |
(character or integr) column to be used as reference |
nEqu |
(logical) if |
supl |
(numeric) supplemental parameters for the various summarizing functions (eg used with |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Details
The argument method allows options that treat (summarize) all columns independently or to select one line (based on argument refCol)
Value
vector with summary for each column
See Also
colSums; if data has subgroups to be used in a tapply-way please see makeNRedMatr
Examples
t1 <- matrix(round(runif(30,1,9)),nc=3); rownames(t1) <- letters[c(1:5,3:4,6:4)]
summarizeCols(t1, me="median")
t(sapply(by(t1,rownames(t1), function(x) x), summarizeCols,me="maxAbsLast"))
t3 <- data.frame(ref=rep(11:15,3), tx=letters[1:15],
matrix(round(runif(30,-3,2),1), ncol=2), stringsAsFactors=FALSE)
by(t3,t3[,1], function(x) x)
by(t3,t3[,1], function(x) summarizeCols(x, me="maxAbsLast"))
t(sapply(by(t3, t3[,1], function(x) x), summarizeCols, me="maxAbsLast"))
System-date (compressed format)
Description
This function returns current date (based on Sys.Date) in different format options.
Usage
sysDate(style = "univ1")
Arguments
style |
(character) choose style (default 'univ1' for very compact style) |
Details
Multiple options for formatting exist : 'univ1' or 'wr' ... (default) compact sytle using day, first 3 letters of English name of month (lowercaps) and last 2 letters of year as ddmmmyy, eg 14jun21
'univ2' ... as ddMmmyy, eg 14Jun21
'univ3' ... as ddMonthyyyy, eg 14June2021
'univ4' ... as ddmonthyyyy, eg 14june2021
'univ5' ... as yyyy-mm-dd (output of Sys.Date()), eg 2021-06-14
'univ6' ... as yyyy-number of day (in year), eg 2021-165
'local1' ... compact sytle using day, first 3 letters of current locale name of month (not necessarily unique !) and last 2 letters of year as ddmmmyy, eg 14jui21
'local2' ... as ddMmmyy, month based on current locale (not necessarily unique !), eg 14Jui21
'local3' ... as ddMonthyyyy, month based on current locale , eg 14Juin2021
'local4' ... as ddmonthyyyy, month based on current locale , eg 14juin2021
'local5' ... as dd-month-yyyy, month based on current locale , eg 14-juin-2021
'local6' ... as yyyymonthddd, month based on current locale , eg 2021juin14
Value
character vector with formatted date
See Also
Examples
sysDate()
t.test on all individual values against all other values
Description
Run t.test on each indiv value of x against all its neighbours (=remaining values of same vector) in order to test if tis value is likely to belong to vector x. This represents a repeated leave-one-out testing. Mutiple choices for multiple testing correction are available.
Usage
tTestAllVal(
x,
alph = 0.05,
alternative = "two.sided",
p.adj = NULL,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
matrix or data.frame |
alph |
(numeric) threshold alpha (passed to |
alternative |
(character) will be passed to |
p.adj |
(character) multiple test correction : may be NULL (no correction), "BH","BY","holm","hochberg" or "bonferroni" (but not 'fdr' since this may be confounded with local false discovery rate), see |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a numeric vector with p-values or FDR (depending on argument p.adj)
See Also
Examples
set.seed(2016); x1 <- rnorm(100)
allTests1 <- tTestAllVal(x1)
hist(allTests1,breaks="FD")
Print matrix-content as plot
Description
This function prints all columns of matrix in plotting region for easier inclusion to reports (default values are set to work for output as A4-sized pdf).
It was made for integrating listings of text to graphical output to devices like png, jpeg or pdf.
Usage
tableToPlot(
matr,
colPos = c(0.05, 0.35, 0.41, 0.56),
useCex = 0.7,
useAdj = c(0, 1, 1, 0),
titOffS = 0,
useCol = 1,
silent = FALSE,
callFrom = NULL
)
Arguments
matr |
(matrix) main (character) matrix to display |
colPos |
(numeric) postion of columns on x-scale (from 0 to 1) |
useCex |
(numeric) cex expension factor forsiez of text (may be different for each column) |
useAdj |
(numeric) left/cneter/right alignment for text (may be different for each column) |
titOffS |
(numeric) offset for title line (ralive to 'colPos') |
useCol |
color specification for text (may be different for each column) |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of message(s) produced |
Details
This function was initially designed for listings with small/medium 1st col (eg couner or index), 2nd & 3rd col small and long 3rd col (like file paths).
Obviously, the final number of lines one can pack and still read correctly into the graphical output depends on the size of the device
(on a pdf of size A4 one can pack up to apr. 11O lines).
Of ourse, Sweave, combined with LaTeX, provides a powerful alternative for wrapping text to pdf-output (and further combining text and graphics).
Note: The final result on pdf devices may vary depending on screen-size (ie with of current device), the parameters 'colPos' and 'titOffS' may need some refinements.
Note: In view of typical page/figure layouts like A4, the plotting region will be split to avoid too wide spacing between rows with less than 30 rows.
Value
This function returns NULL (no R-object returned), print 'plot' in current device only
See Also
Sweave for more flexible framework
Examples
## as example let's make a listing of file-names and associated parameters in current directory
mat <- dir()
mat <- cbind(no=1:length(mat),fileName=mat,mode=file.mode(mat),
si=round(file.size(mat)/1024),path=getwd())
## Now, we wrap all text into a figure (which could be saved as jpg, pdf etc)
tableToPlot(mat[,-1],colPos=c(0.01,0.4,0.46,0.6),titOffS=c(0.05,-0.03,-0.01,0.06))
tableToPlot(mat,colPos=c(0,0.16,0.36,0.42,0.75),useAdj=0.5,titOffS=c(-0.01,0,-0.01,0,-0.1))
2-Factorial Limma-Style t-Test
Description
The aim of this function is to provide convenient acces to two-factorial (linear) testing withing the framework of makeMAList including the emprical Bayes shrinkage.
The input data 'datMatr' which should already be organized as limma-type MAList, eg using using makeMAList.
Note: This function uses the Bioconductor package limma (which must be installed).
Usage
test2factLimma(
datMatr,
fac1,
fac2,
testSynerg = FALSE,
testOrientation = "=",
addResults = c("lfdr", "FDR", "Mval", "means"),
addGenes = NULL,
silent = FALSE,
callFrom = NULL,
debug = FALSE
)
Arguments
datMatr |
matrix or data.frame with lines as indenpendent series of measures (eg different genes) |
fac1 |
(character or factor) vector describing grouping elements of each line of 'datMatr' for first factor, must be of same langth as fac2 |
fac2 |
(character or factor) vector describing grouping elements of each line of 'datMatr' for second factor, must be of same langth as fac1 |
testSynerg |
(logical) decide if factor-interactions (eg synergy) should be tested in model, otherwise additive factors are supposed |
testOrientation |
(character) default (or any non-recignized input) '=', otherwise either '>','gerater','sup','upper' or '<','inf','lower' |
addResults |
(character) vector defining which types of information should be included to output, may be 'lfdr','FDR' (for BY correction), 'Mval' (M values), 'means' (matrix with mean values for each group of replicates) |
addGenes |
(matrix or data.frame) additional information to add to output |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) additional messages for debugging |
Value
This function returns an object of class "MArrayLM" (from limma) containing/enriched by the testing results
See Also
makeMAList, single line testing lmFit and the eBayes-family of functions in package limma
Examples
set.seed(2014)
dat0 <- rnorm(30) + rep(c(10,15,19,20),c(9,8,7,6))
fa <- factor(rep(letters[1:4],c(9,8,7,6)))
dat2 <- data.frame(facA=rep(c("-","A","-","A"), c(9,8,7,6)),
facB= rep(c("-","-","B","B"), c(9,8,7,6)), dat1=dat0, dat2=runif(30))
grpNa <- sub("-","",sub("\\.","", apply(dat2[,1:2], 1, paste, collapse="")))
test2f <- test2factLimma(t(dat2[,3:4]), dat2$facA, dat2$facB)
test2f # just the p-values
# Similarly, you can easily summarize results using topTable from limma
if(requireNamespace("limma", quietly=TRUE)) {
test2g <- test2factLimma(t(dat2[,3:4]), dat2$facA, dat2$facB, addR=FALSE)
library(limma)
topTable(test2g, coef=1, n=5)
topTable(test2g, coef=2, n=5) }
Mean Of 3 Highest Values
Description
This function returns the mean of the top3 highest values.
Usage
top3mean(x, silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
x |
(numeric vector) main input |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Details
Generally, NA will be excluded, if all values are NA this finction will return NULL ;
thus, in case of (entirely) unsuitable data (non-numeric ...) NULL will be returned.
If data has subgroups you may try a tapply -way.
Value
This function returns a vector with single numeric value for mean of top3
( returns NULL with invalid input or if all input is NA)
See Also
Examples
x1 <- c(15:11,NA,16)
top3mean(x1)
Make single vector gray-gradient
Description
This function helps making gray-gradients.
Note : The resulting color gradient does not seem linear to the human eye, you may try gray.colors instead
Usage
transpGraySca(startGray = 0.2, endGrey = 0.8, nSteps = 5, transp = 0.3)
Arguments
startGray |
(numeric) gray shade at start |
endGrey |
(numeric) gray shade at end |
nSteps |
(integer) number of levels |
transp |
(numeric) transparency alpha |
Value
character vector (of same length as x) with color encoding
See Also
Examples
layout(1:2)
col1 <- transpGraySca(0.8,0.3,7,0.9)
pie(rep(1,length(col1)), col=col1, main="from transpGraySca")
col2 <- gray.colors(7,0.9,0.3,alph=0.9)
pie(rep(1,length(col2)), col=col2, main="from gray.colors")
Locate duplicates in text and make non-redundant
Description
treatTxtDuplicates locates duplictes in character-vector 'x' and return list (length=3) : with $init (initial),
$nRed .. non-redundant text by adding number at end or beginning, and $nrLst .. list-version with indexes per unique entry.
Note : NAs (if multiple) will be renamed to NA_1, NA_2
Usage
treatTxtDuplicates(
x,
atEnd = TRUE,
sep = "_",
onlyCorrectToUnique = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
(character) vector with character-entries to identify (and remove) duplicates |
atEnd |
(logical) decide location of placing the counter (at end or at beginning of ID) (see |
sep |
(character) separator to add before counter when making non-redundant version |
onlyCorrectToUnique |
(logical) if TRUE, return only vector of non-redundant |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
list with $init, $nRed, $nrLst
See Also
For simple correction use correctToUnique
Examples
treatTxtDuplicates(c("li0",NA,rep(c("li2","li3"),2)))
correctToUnique(c("li0",NA,rep(c("li2","li3"),2)))
Pairwise x,y Combinations
Description
This function gets pairwise combinations for 'n' elements; returns matrix with x & y coordinates to form all pairwise groups for 1:n elements
Usage
triCoord(n, side = "upper", silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
n |
(integer) number of elements for making all pair-wise combinations |
side |
(character) "upper" or "lower" |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a 2-column matrix with indexes for all pairwise combinations of 1:n
See Also
upperMaCoord, getPWseparator, indexGroupsFromPW, diffCombin; combn, lower.tri or upper.tri, simpler version upperMaCoord
Examples
triCoord(4)
Trim redundant text
Description
This function allows trimming/removing redundant text-fragments (redundant from head or tail) out of character vector 'txt'.
Usage
trimRedundText(
txt,
minNchar = 1,
side = "both",
spaceElim = FALSE,
silent = TRUE,
callFrom = NULL,
debug = FALSE
)
Arguments
txt |
character vector to be treated |
minNchar |
(integer) minumin number of characters that must remain |
side |
(character) may be be either 'both', 'left' or 'right' |
spaceElim |
(logical) optional removal of any heading or tailing white space |
silent |
(logical) suppress messages |
callFrom |
(character) allows easier tracking of messages produced |
debug |
(logical) display additional messages for debugging |
Value
This function returns a modified character vector
See Also
rmSharedWords; Inverse search : Find/keep common text keepCommonText; checkUnitPrefix;
you may also look for related functions in package stringr
Examples
txt1 <- c("abcd_ccc","bcd_ccc","cde_ccc")
trimRedundText(txt1, side="right") # trim from right
txt2 <- c("ddd_ab","ddd_bcd","ddd_cde")
trimRedundText(txt2, side="left") # trim from left
Trimmed Mean
Description
This function allows more flexible options for calculating a trimmed mean compared to mean (from the base-package).
For example, the trimming may be asymmetric to the median of the data.
Usage
trimmedMean(
dat,
trim = c(l = 0.2, u = 0.2),
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat |
(numeric) numeric vector |
trim |
(numeric, length=2) specifies how data should get trimmed, lower and upper fraction(s) to exclude have to be assigned separately. The lower and upper fraction may be named 'l' and 'u'. The value 0 means that all (sorted) data on a given side will be used. |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Details
If the second value of trim is <0.5 it is supposed that this indicates a fraction from the upper end the vector-dat as mean does.
Otherwise, trim=c(l=0.2,u=0.7) will be interpreted indication to use the 20th percentile to 70th percentile of dat.
Please note, that trimmed means - and in particular asymmetric trimmed means - should be used with caution as there is also a risk of introducing bias.
Value
This function returns a (numeric) vector with the trimmed mean
See Also
mean (symmetric trimming only)
Examples
x <- c(17:11,27:28)
mean(x); mean(x, trim=0.15)
trimmedMean(x, trim=c(l=0, u=0.7)) # asymmetric trim
Truncating Text Vector To Specific Length
Description
This function allows truncating a text vector (or matrix of text) at nMax number of characters with optional adding of truncation/ending sign and trimming after last separator.
Usage
truncateVect(
x,
nMax = 20,
sep = NULL,
appendChar = "...",
startFrom = 1,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
(character or matrix of text) main input, text to be truncated |
nMax |
(integer, length=1) max length in number of characters to be returned |
sep |
(character or |
appendChar |
(character, length=1) optional set of characters to add at end when trucation has happened (default '...'); set to |
startFrom |
(integer, length=1) designes the first character to be extracted (see also |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
convenient access to results produced using the functions substr or moderTest2grp.
The user can define the threshold and which type of multiple testing correction should be used
(as long as the multiple testing correction method cited was actually performed as part of testing).
This function builds on substr but offers additional options for trimming at right side of text:
In contrast to substr where the absolute position number has to be given, this function takes
the max desired length of the resulting character vector (argument nMax).
The argument appendChar allows adding extra characters (default '...') indicating that trimmming has been performed.
When doing so, the text will be trimmed further inside to ensure the final length of the resulting text, as defined by argument nMax.
Furthermore, using the argument sep it is possible to respect entities between separators and only cut at/before such separators
(the resulting text vecor may thus be shorter than specified globally with argument nMax).
Value
This function returns a data.frame or matrix (if no annotation added) with values (and annotation) conform to fiter criteria
See Also
Examples
txt <- c("abc", "abcdefgh", "abc/def/gh")
truncateVect(txt, nMax=7, appendChar="..")
truncateVect(txt, nMax=7, sep="/", appendChar="..")
Unify Enumerators
Description
The aim of this function is to provide help in automatically harmonizing enumerators at the end of sample-names.
When data have same grouped setup/design, many times this is reflected in their names, eg 'A_sample1', 'A_sample2' and 'B_sample1'.
However, human operators may use multiple similar (but not identical) ways of expressing the same meanin, eg writng 'A_Samp_1'.
This function allows testing a panel of different extensions of enumerators and (if recognized) to replace them by a user-defined standard text/enumerator.
Please note that the more recent function rmEnumeratorName offers better/more flexible options.
Usage
unifyEnumerator(
x,
refSep = "_",
baseSep = c("\\-", "\\ ", "\\."),
suplEnu = c("Repl", "Rep", "R", "Number", "No", "Sample", "Samp"),
stringentMatch = TRUE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
(character) main input |
refSep |
(character) separator for output |
baseSep |
(character) basic seprators to test (you have to protect special characters) |
suplEnu |
(character) additional text |
stringentMatch |
(logical) decide if enumerator text has to be found in all instances or only once |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
This function has been developed for matching series of the same samples passing in parallel through different evaluation software (see R package wrProteo). The way human operators may name things may easily leave room for surprises and this function allows testing only a limited number of common ways of writing. Thus, in any case, the user is advised to inspect the results by eye and - if needed- to adjust the parameters.
Basically enumerator separators can be constructed by combing a base-separator baseSep (like '-', '_' etc) and an enumerator-abbreviation suplEnu.
Then, all possible combinations will be tested if they occur in the text x.
Furthermore, the text searched has to be followd by on or multiple digts at the end of text-entry (decimal comma-separators etc are not allowed).
Thus, if there is other 'free text' following to the right after the enumerator-text this function will not find any enumerators to replace.
The argument stringentMatch allows defining if this text has to be found in all text-entries of x or just one of them.
Whe using stringentMatch=FALSE there is risk that other text not meant to design enumerators may be picked up and modified.
Please note, that with large data-sets (ie many columns) testing/checking a larger panel of enumerator-abreviations may result in slower performance. In cases of larger data-sets it may be more effective to first study the data and then run simple subsitions using sub targeted for this very case.
Value
This function returns a character vector of same length as input x, with it's content as adjusted enumerators
See Also
rmEnumeratorName for better/more flexible options; grep or sub(), etc if exact and consistent patterns are known
Examples
unifyEnumerator(c("ab-1","ab-2","c-3"))
unifyEnumerator(c("ab-R1","ab-R2","c-R3"))
unifyEnumerator(c("ab-1","c3-2","dR3"), strin=FALSE);
Report number of unique and redundant elements (optional figure)
Description
Make report about number of unique and redundant elements of vector 'dat'. Note : fairly slow for long vectors !!
Usage
uniqCountReport(
dat,
frL = NULL,
plotDispl = FALSE,
tit = NULL,
col = NULL,
radius = 0.9,
sizeTo = NULL,
clockwise = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
dat |
(charcter or numeric vector) main input where number of unique (and redunant) should be determined |
frL |
(logical) optional (re-)introducing results from |
plotDispl |
(logical) decide if pie-type plot should be produced |
tit |
(character) optional title in plot |
col |
(character) custom colors in pie |
radius |
(numeric) radius passed to |
sizeTo |
(numeric or charcter) optional reference group for size-population relative adjusting overall surface of pie |
clockwise |
(logical) argument passed to pie |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
vector with counts of n (total), nUnique (wo any repeated), nHasRepeated (first of repeated), nRedundant), optional figure
See Also
Examples
layout(1:2)
uniqCountReport(rep(1:7,1:7),plot=TRUE)
uniqCountReport(rep(1:3,1:3),plot=TRUE,sizeTo=rep(1:7,1:7))
(upper) pairwise x,y combinations
Description
upperMaCoord gets pairwise combinations for 'n' elements; return matrix with x & y coordinates to form all pairwise groups for n elements.
But no distinction of 'upper' or 'lower' possible like in triCoord
Usage
upperMaCoord(n, silent = FALSE, debug = FALSE, callFrom = NULL)
Arguments
n |
(integer) number of elements for making all pair-wise combinations |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Value
This function returns a 2-column matrix wiyh indexes for all pairwise combinations of 1:n
See Also
lower.tri, more evolved version triCoord
Examples
upperMaCoord(4)
Vector Distance and Angle
Description
Compute the Euclidean distance and angle (in radians) for 2-dimensional vectors defined by
start and end points in the first and second columns of argumnents x and y.
Usage
vectorDistAngle(
x,
y,
addCoord = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
(numeric matrix or data.frame of 2 column, min 2 rows) describes start & end x-coordinates |
y |
(numeric matrix or data.frame of 2 column, min 2 rows) describes start & end x-coordinates |
addCoord |
(logical) add original start and end-coordinates to output |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced). |
Details
The input x and y is considered as describing start- and enc-points of vectors in two-dim space.
Each row of x describes the starting and end-points of separate (and independent) vectors along the x- and y-axis.
Then, the function calculates for each line the **distance** as Euclidean distance and the **angle** as atan2(y_diff, x_diff)' in radians (range: '[-pi, pi]'), measured counterclockwise from the positive x-axis.
This function was designed for movement trajectories or any paired
coordinate data where direction and magnitude matter.
If x and y contain more than 2 columns, these additional columns will be ignored.
Value
This function returns a data.frame with the columns:
`dist` |
Numeric vector of Euclidean distances |
`angle` |
Numeric vector of angles in radians |
Optionally the original start and end-coordinates to output may get added if addCoord=TRUE
See Also
Examples
x <- matrix(c(0, 3, 0.5, 4, 1, 1), ncol=2, byrow=TRUE) # x: (0,0)→(3,0), (0,0)→(4,0), (0,0)→(0,0)
y <- matrix(c(0, 0, 1, 3, 0.5, 5), ncol=2, byrow=TRUE) # y: (0,0)→(0,0), (0,0)→(3,0), (0,0)→(5,0)
(vectDist <- vectorDistAngle(x, y))
plot(cbind(x=as.numeric(x),y=as.numeric(y)), main="Example for vectorDistAngle()",las=1)
arrows(x[,1],y[,1],x[,2],y[,2])
text(x[,2], 0.1 +y[,2], paste0("dist=",round(vectDist[,1],2),
", angle=",round(vectDist[,2],2)), adj=1)
Filter Statistical Testing Results in Volcano-Plot Like Fashion This function allows filtering statistical testing results combined with M-values (log2 fold-change) and other filtering criteria. All suitable values can be extracted from objects created from package wrProteo (and limma) may get used automatically. The outcome can be used for Volcano-plots or exporting tables.
Description
Filter Statistical Testing Results in Volcano-Plot Like Fashion
This function allows filtering statistical testing results combined with M-values (log2 fold-change) and other filtering criteria. All suitable values can be extracted from objects created from package wrProteo (and limma) may get used automatically. The outcome can be used for Volcano-plots or exporting tables.
Usage
volcanoFilter(
Mvalue,
pValue = NULL,
useComp = 1,
filtFin = NULL,
FCthrs = NULL,
FdrList = NULL,
FdrThrs = NULL,
FdrType = NULL,
signifOnly = TRUE,
annotColumn = c("SpecType", "GeneName", "EntryName", "Accession", "Species", "Contam"),
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
Mvalue |
(numeric, list or of class 'MArrayLM') vector of M-values (log2 fold-change) or output from |
pValue |
(numeric) statistical testing results, only used in case argument |
useComp |
(integer or character) in case argument |
filtFin |
(logical or matrix) optional vector to provide/include results from other additional filtering (columns should maych columns of |
FCthrs |
(numeric) threshold for M-values (as log2(fold-change)), defaults to 1 |
FdrList |
(vector, matrix or data.frame) additional statistical testing results for multiple testing correction, used for apply |
FdrThrs |
(numeric) threshold for filtering |
FdrType |
(character) choose which multiple correction testing shoulbe used for filtering (only if argument |
signifOnly |
(logical) decide if only filtered data or complete table should be returned |
annotColumn |
(character) additional elements from $annot to extract too if |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Details
This function offers support for combined filtering along a significance-threshold (flexible choice of type of multiple testing correction)
combined with M-values (log2 fold-change) and other filtering results (already present in objects from package wrProteo).
Even though basic filtering can be performed using separated vectors (see example below), the main advantage relies on automatically recognizing
the structure of results from testRobustToNAimputation() from package wrProteo.
In case of using with separate vectors the original p-values may be provided without or with multiple-testing corrected values (argument FdrList.
If no multiple-testing correctio is provided it will be calculated using the Benjamini-Hochberg formula from p.adjust.
Note : M-value data is assumed to be log2-transformed ratios !
Value
This function returns a matrix (or in some instances a data.frame) combining (at least) the columns 'FDRvalue', 'Mvalue', 'pValue', 'filtFin' and 'retain'
See Also
testRobustToNAimputation and extractTestingResults from package wrProteo, or filter_volcano from package genefilter, p.adjust
Examples
set.seed(2025); means1 <- matrix(rnorm(2*95) +seq(1,3, length.out=2*95),
ncol=2, byrow=TRUE, dimnames=list(NULL, LETTERS[3:2]))
means1 <- rbind(means1, cbind((3:7)/2, c(6:8, -2:-3)))
rownames(means1) <- paste0("li_",sprintf(paste0("%03d"), 1:100))
Mval0 <- means1[,1] - means1[,2]
Mval1 <- matrix(means1[,1] - means1[,2], ncol=1, dimnames=list(rownames(means1), "C-B"))
set.seed(2026); pVal0 <- c(runif(95, max=0.9), (4:8)^(-4:-8))
FdrVal1 <- matrix(p.adjust(pVal0, method="BH"), ncol=1, dimnames=list(rownames(means1), "C-B"))
pVal1 <- matrix(pVal0, ncol=1, dimnames=list(rownames(means1), "C-B"))
## with separate entries ...
filt1 <- volcanoFilter(Mvalue=Mval1, pValue=pVal1) # separate values
tail(signif(filt1, 3))
## separate entries, retrieve all data for Volcano-Plot
filt2 <- volcanoFilter(Mvalue=Mval1, pValue=pVal1, signifOnly=FALSE) # separate values
tail(signif(filt2, 3))
plot(filt2[,2], -1*log10(filt2[,3]), col=c("grey","red")[1+filt2[,5]], pch=16, main="Volcano-Plot")
## simulate basic/minimal object from wrProteo
Mobj3 <- list(means=means1, BH=FdrVal1, p.value=pVal1)
filt3 <- volcanoFilter(Mobj3)
tail(signif(filt3, 3))
Check For Values Within Range Of Reference
Description
This function checks which values of numeric vector 'x' are within range +/- 'fa' x 'ref' (ie within range of reference).
Usage
withinRefRange(
x,
fa,
ref = NULL,
absRef = TRUE,
asInd = FALSE,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
x |
matrix or data.frame |
fa |
(numeric) absolute or relative tolerance value (numeric, length=1), interpreted according to 'absRef' as absolute or relative to 'x'(ie fa*ref) |
ref |
(numeric) (center) reference value for comparison (numeric, length=1), if not given mean of 'x' (excluding NA or non-finite values) will be used |
absRef |
(logical) return result as absolute or relative to 'x'(ie fa*ref) |
asInd |
(logical) if TRUE return index of which values of 'x' are within range, otherwise return values if 'x' within range |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Value
This function returns a numeric vector containing only the values within range of reference
Examples
## within 2.5 +/- 0.7
withinRefRange(-5:6,fa=0.7,ref=2.5)
## within 2.5 +/- (0.7*2.5)
withinRefRange(-5:6,fa=0.7,ref=2.5,absRef=FALSE)
Write (And Convert) Csv Files
Description
This functions allows for more options when writing data into csv-files compated to write.csv.
Usage
writeCsv(
input,
inPutFi = NULL,
expTy = c("Eur", "US"),
imporTy = "Eur",
filename = NULL,
quote = FALSE,
filterCol = NULL,
replMatr = NULL,
returnOut = FALSE,
SYLKprevent = TRUE,
digits = 22,
silent = FALSE,
debug = FALSE,
callFrom = NULL
)
Arguments
input |
either matrix or data.frame |
inPutFi |
(character or |
expTy |
(character) 'US' and/or 'Eur' for sparator and decimal type in output |
imporTy |
(character) default 'Eur' (otherwise set to 'US') |
filename |
(character) optional new file name(s) |
quote |
(logical) will be passed to function |
filterCol |
(integer or character) optionally, to export only the columns specified here |
replMatr |
optional, matrix (1st line:search, 2nd li:use for replacing) indicating which characters need to be replaced ) |
returnOut |
(logical) return output as object |
SYLKprevent |
(logical) prevent difficulty when opening file via Excel. In some cases Excel presumes (by error) the SYLK format and produces an error when trying to open files : To prevent this, if necessary, the 1st column-name will be changed from 'ID' to 'Id'. |
digits |
(interger) limit number of signif digits in output (ie file) |
silent |
(logical) suppress messages |
debug |
(logical) for bug-tracking: more/enhanced messages |
callFrom |
(character) allow easier tracking of messages produced |
Details
The main input may be gven as R-object or read from file 'input'. Then, one can (re-)write using specified conversions. An optional filter to select columns (column-name specified via 'filterCol') is available.
The output may be simultaneaously written to multiple formats, as specified in 'expTy', tabulation characters may be converted to avoid accidentally split/shift text to multiple columns. Note: Mixing '.' and ',' as comma separators via text-columns or fused text&data may cause problems lateron, though.
Value
This function writes a file to disk and returns NULL unless returnOut=TRUE
See Also
write.csv in write.table, batch reading using this package readCsvBatch
Examples
dat1 <- data.frame(ini=letters[1:5],x1=1:5,x2=11:15,t1=c("10,10","20.20","11,11","21,21","33.33"),
t2=c("10,11","20.21","kl;kl","az,az","ze.ze"))
fiNa <- file.path(tempdir(), paste("test",1:2,".csv",sep=""))
writeCsv(dat1, filename=fiNa[1])
dir(path=tempdir(), pattern="cs")
(writeCsv(dat1, replM=rbind(bad=c(";",","), replBy="__"), expTy=c("Eur"),
returnOut=TRUE, filename=fiNa[2]))